ELF(4T 4 (#"pt t t     @46   QtdRtd   ((CbqNpB1_tK@h^cs;|AjF,&\vr5 YIJXmW8qO( #\k1M*Z*!lEQ+3$SN "xjio=T'L`RH?>]hs2d4e<[+0gHD=d8E:ofnP@"a yA{$ KRW)/Il('uMfwn&gY[xL: zJ]yrQ}-k.ZG%F0tv6<>{5P}_ zO/b |u7G4-69)p,`m?#.^U2V9! XB V;%T ci~aDwC7US ~3eap L@P@@H 0 : " ĄE  X QJN`hhA (pqrtwxy{}~-0,Je&F1]ԅ۷s͹ o o$t`b$ƭ="h+p'GksSxFSK fLR̝B#9{_FGs8}4/_:I˖q3#AGQ[:"  |@3  7M8sCc d ol8fG_ s{ * :D2 K"5m Q DsUYm Ix7Kk 1   F I GH# RT  p <'Q[P6~n pO:  k 7    n7Eq"o^ [# ln El :( P \ $ `< P  V8l К RK E i CW L k( 2< >G +l  dh 0 |o `| bL pD ~ h h _W  9 t +\, F &` f( h0 rTN  dR d D\ r (SX P U 4 qa S@ |Q . | w  \  0   - c(8 8;  lH<  0t V  dj ,lG0 |E|  h` t X j d0X 0V ԙT Q $QX :L $,U ^x Qw 1 ' ( $ X=  |, ox zH g Dl    $p DP F C, p k Pg > 4(  y| Bp i lC X Sl __gmon_start____cxa_finalizestrlencurl_strnequalmemcpyfopen64fclosefwriteunlinkinet_ptoncurl_mfprintfstrchrpthread_mutex_lockpthread_mutex_unlockpthread_mutex_destroy__sigsetjmp__pthread_register_cancel__pthread_unregister_cancelcurl_msnprintf__errno_locationpthread_setcancelstate__pthread_unwind_nextmemsetpthread_mutex_initcurl_freestrncmpcurl_easy_strerrorsetsockoptbindgetsockoptgetsocknameaccept4getpeernamememchrsigactioninet_ntopinflateInit_inflateInit2_inflateEndinflateinflateReset2curl_strequalstpcpycurl_maprintfmemrchrstrcspnstrcmpstrrchrstdinqsortcurl_slist_free_allstdoutgetaddrinfofreeaddrinfofnmatchfeoffgetsgethostnameDES_set_odd_parityDES_set_key_uncheckedDES_ecb_encryptmemcmpEVP_MD_CTX_newEVP_sha512_256EVP_DigestInit_exEVP_MD_CTX_freeEVP_DigestUpdateEVP_DigestFinal_expthread_createpthread_detachpthread_joinpthread_cancelcurl_mvsnprintfstrcpycurl_mvaprintfcurl_slist_appendcurl_easy_setoptcurl_multi_add_handlestderrcurl_multi_remove_handlemallocreallocstrdupcalloccurl_multi_setoptcurl_multi_cleanupcurl_multi_pollcurl_multi_performcurl_multi_info_readcurl_global_initsched_yieldcurl_global_init_memcurl_global_cleanupcurl_global_tracecurl_global_sslsetcurl_easy_initcurl_easy_performcurl_easy_cleanupcurl_easy_getinfocurl_easy_duphandlecurl_easy_resetcurl_easy_pausecurl_easy_recvcurl_easy_sendcurl_easy_upkeepcurl_easy_ssls_importcurl_easy_ssls_exportcurl_easy_option_by_namecurl_easy_option_by_idcurl_easy_option_nextcurl_easy_escapecurl_escapecurl_easy_unescapecurl_unescapefstat64lseek64opendirreaddir64closedirfilenofdopenfseeko64curl_mime_namecurl_mime_initcurl_mime_subpartscurl_mime_addpartcurl_mime_headerscurl_mime_typecurl_mime_data_cbcurl_mime_filenamecurl_mime_datacurl_mime_filedatafreadcurl_formaddcurl_formgetcurl_formfreelistenstrstrcurl_getenvcurl_easy_headercurl_easy_nextheadercurl_url_setcurl_url_getcurl_url_strerrorcurl_urlcurl_url_cleanup__isoc23_strtolmemmovecurl_url_dupcurl_pushheader_bynumcurl_pushheader_bynamestrftimegetifaddrsfreeifaddrsMD5_FinalMD5_UpdateMD5_Initfseekcurl_mime_free__xpg_basenamecurl_mime_encoderfputccurl_msprintfcurl_mprintfcurl_mvsprintfcurl_mvprintfcurl_mvfprintfcurl_multi_initcurl_multi_wakeupcurl_multi_assigncurl_multi_get_handlescurl_multi_get_offtcurl_multi_timeoutcurl_multi_fdsetcurl_multi_waitfdscurl_multi_waitcurl_multi_socket_allcurl_multi_socket_actioncurl_multi_socketgeteuidgetpwuid_rcurl_getdategmtime_rfflushrenameEVP_sha256curl_share_initcurl_share_setoptcurl_share_cleanupeventfdcurl_multi_strerrorcurl_share_strerrorstrerror_rsendtorecvfromif_nametoindexstrspncurl_versionzlibVersioncurl_version_infocurl_ws_recvcurl_ws_sendcurl_ws_metacurl_ws_start_framestrpbrksetvbuffputsX509_STORE_freeSSL_alert_desc_string_longOSSL_PROVIDER_unloadOSSL_LIB_CTX_freeENGINE_finishENGINE_freeUI_get_string_typeUI_OpenSSLUI_method_get_writerUI_get0_user_dataUI_get_input_flagsUI_method_get_readerUI_set_resultBIO_s_memBIO_newX509_NAME_print_exBIO_ctrlBIO_freeOpenSSL_versionSSL_get1_peer_certificateX509_get_signature_nidOBJ_find_sigid_algsOBJ_nid2snEVP_get_digestbynameX509_digestEVP_DigestInitENGINE_get_firstENGINE_get_nextENGINE_get_idENGINE_set_defaultSSL_freeSSL_CTX_freeBIO_meth_freeBIO_set_shutdownBIO_set_initBIO_set_dataBIO_get_dataBIO_get_shutdownBIO_clear_flagsBIO_set_flagsOPENSSL_init_sslERR_error_string_nOSSL_LIB_CTX_load_configOSSL_PROVIDER_availableOSSL_PROVIDER_try_loadOSSL_LIB_CTX_newERR_get_errorENGINE_by_idENGINE_initERR_clear_errorSSL_writeSSL_get_errorSSL_readSSL_write_early_dataSSL_get_shutdownSSL_shutdownRAND_statusRAND_bytesBN_printi2d_SSL_SESSIONSSL_SESSION_get_max_early_dataSSL_SESSION_get_timeoutSSL_get_ex_dataERR_set_markX509_STORE_up_refSSL_CTX_set_cert_storeSSL_CTX_get_cert_storeBIO_new_mem_bufPEM_X509_INFO_read_bioOPENSSL_sk_valueX509_STORE_add_certX509_STORE_add_crlOPENSSL_sk_numOPENSSL_sk_pop_freeX509_STORE_load_fileX509_LOOKUP_fileX509_STORE_add_lookupX509_load_crl_fileX509_STORE_set_flagsERR_pop_to_markX509_STORE_load_pathX509_INFO_freeTLS_methodSSL_CTX_new_exTLS_client_methodSSL_CTX_newSSL_CTX_set_msg_callbackSSL_CTX_ctrlSSL_CTX_set_optionsSSL_CTX_set_default_read_buffer_lenSSL_CTX_set_default_passwd_cb_userdataSSL_CTX_set_default_passwd_cbd2i_X509_bioSSL_CTX_use_certificateX509_freed2i_PrivateKey_bioSSL_CTX_use_PrivateKeyEVP_PKEY_freeSSL_newSSL_get_certificateX509_get_pubkeySSL_get_privatekeyEVP_PKEY_copy_parametersEVP_PKEY_get_idSSL_CTX_check_private_keySSL_CTX_set_post_handshake_authSSL_CTX_set_srp_usernameSSL_CTX_set_srp_passwordSSL_CTX_set_verifySSL_CTX_sess_set_new_cbSSL_set_ex_dataSSL_set_connect_stateSSL_ctrlERR_peek_errorSSL_CTX_set_cipher_listSSL_CTX_set_ciphersuitesSSL_CTX_set_keylog_callbackd2i_PKCS12_bioPKCS12_PBE_addPKCS12_parsePKCS12_freeSSL_set_alpn_protosPEM_read_bio_X509_AUXUI_create_methodUI_method_get_openerUI_method_set_openerUI_method_get_closerUI_method_set_closerUI_method_set_readerUI_method_set_writerOSSL_STORE_open_exOSSL_STORE_expectOSSL_STORE_loadOSSL_STORE_INFO_get_typeOSSL_STORE_INFO_freeOSSL_STORE_closeUI_destroy_methodENGINE_ctrlENGINE_ctrl_cmdENGINE_load_private_keyEVP_PKEY_get1_RSARSA_flagsRSA_freeSSL_CTX_use_certificate_chain_fileSSL_CTX_use_PrivateKey_fileSSL_CTX_use_certificate_fileBIO_s_fileOPENSSL_sk_popSSL_CTX_add_client_CAPEM_read_bio_PrivateKeyd2i_SSL_SESSIONSSL_set_sessionSSL_SESSION_freePEM_read_bio_X509ERR_peek_last_errorOSSL_STORE_INFO_get1_CERTOSSL_STORE_INFO_get1_PKEYSSL_get_peer_signature_type_nidSSL_get0_group_nameSSL_get_versionSSL_get_current_cipherSSL_CIPHER_get_nameSSL_connectSSL_get0_alpn_selectedSSL_get_verify_resultX509_verify_cert_error_stringX509_get_subject_nameX509_get0_notBeforeASN1_TIME_printX509_get0_notAfterASN1_STRING_get0_dataASN1_STRING_lengthGENERAL_NAMES_freeX509_get_issuer_nameSSL_get_peer_cert_chainEVP_PKEY_get0_type_nameX509_get0_signatureX509_ALGOR_get0OBJ_obj2txtX509_get0_pubkeyEVP_PKEY_get_bitsEVP_PKEY_get_security_bitsEVP_PKEY_get_group_nameX509_check_issuedX509_get_versionBIO_printfX509_get_serialNumberi2a_ASN1_OBJECTX509_get_X509_PUBKEYX509_PUBKEY_get0_paramX509_get0_extensionsX509_EXTENSION_get_objecti2t_ASN1_OBJECTX509V3_EXT_printX509_EXTENSION_get_dataASN1_STRING_printSSL_get0_verified_chainX509_get_ext_d2id2i_OCSP_RESPONSEOCSP_response_statusOCSP_response_get1_basicOCSP_basic_verifyOCSP_BASICRESP_freeOCSP_RESPONSE_freeEVP_PKEY_get_bn_paramBN_num_bitsPEM_write_bio_X509i2d_X509_PUBKEYBIO_putsX509_NAME_get_index_by_NIDCRYPTO_freeBN_clear_freeX509_NAME_get_entryX509_NAME_ENTRY_get_dataASN1_STRING_typeASN1_STRING_to_UTF8EVP_sha1OCSP_cert_to_idOCSP_resp_find_statusOCSP_CERTID_freeOCSP_response_status_strOCSP_check_validityOCSP_cert_status_strOCSP_crl_reason_strBIO_meth_newBIO_meth_set_writeBIO_meth_set_readBIO_meth_set_ctrlBIO_meth_set_createBIO_meth_set_destroyBIO_up_refSSL_set0_rbioSSL_set0_wbioSSL_get_early_data_statusftellrealpathfcntl64clock_gettimegettimeofdayselectraiselibssl.so.3libcrypto.so.3libz.so.1libc.so.6libcurl.so.4ZLIB_1.2.3.4OPENSSL_3.0.0GLIBC_2.38GLIBC_2.33GLIBC_2.28GLIBC_2.7GLIBC_2.17GLIBC_2.10GLIBC_2.34GLIBC_2.4OPENSSL_3.2.0       4 +p   ii ii y -p & +p    ( 0 4 8 @ D H L P X ` d h p |               ( 0 8 @ H P X ` d h l p t x |                                    l p t x |                  $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t           $ 4 D T d t            < @ D H L P T X \ ` d h l p t x |                                   0 4 8 < @ D H L P T X `       8 @ H P X ` h l p t |                $ ( 0 4 8 < @ T X \ ` h l p t x                  0 4 8 @ D L P T X \ ` d h l p t x |                             < @ D H L P T X \ ` d h l p t x |                           ( 0 8 @ H P X \ ` d l p t x |                   ( , 0 8 < @ D H L P T X \ d h l p t x |                                  $ X \ ` l p t x |                        < @ D H L ` d h l t x |                               $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                      $ X d p |                      $ ( , 0 4 8 < @ D H P X \ ` l x                       $ , 4 < D L P T \ d h l t x |                             ( 8 @ D H L T d t x |                       ( , P T h                       0 4 @ T X \ ` h x                        L T X ` d l p t x |                               $ 0 4 8 < @ D H L P T X \ ` l p t x |                                    $ ( , 0 4 8 < @ D H L P \ ` d h l p t x |                                    $ ( , 0 4 8 < @ H P X ` h p x                        $ ( , 0 4 8 < @ D H P X l                        $ ( , 0 4 8 < @ D H L P H P - -\ @h ^             ! Y c h h       $  (  ,  0  4 8 < @ D H L P T X \ ` d h l p t x |   ! " # $ % & ' ( ) * + , { z - . / 0 1 2 3 4 5 6 7 8 9  : ; < = w >  ? A B C D$ ( E, F0 G4 8 ~< H@ ID JH KL LP MT NX O\ r` Pd h Ql Rp St Tx U| V W X Y Z [ \ ]   ^ _ ` a b c  d  e  f g h i j  k l m n o p q  r s t u v w x$ y( z, {0 |4 }8 ~< @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                          $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                         " # $ % & ' ( )$ *( +, ,0 -4 .8 /< 0@ 1D 2H 3L 4P 5T 6X 7\ 8` 9d :h ;l <p =t >x ?| @ A B C D E F G H I p J K L M N O P Q R S T U V W  X Y Z [ \ ] ^ _ ` a b c d e  $ f( g, i0 j4 k8 l< m@ nD o@--k ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌX0 0 R/Y H H0 0R/@-0 0S $0 00 0d X _ c 0@- M@P R 0B.Q R Ѝ0P Ѝ0G-  P`@PT0pS@0S P p40p03/0 3/03/T X G-00 @P4p`4/@P= VU/ U 0E .R& V0 [Rp`F qP qP  00$00(00,010[SPE 0E .RPSP00P03/0 3/03/@@W Lp@-^M` \P ^ߍp4P+LP*P0!(,PP dPP+TP P0l!0 PP,lPP8 0PPP 0@P@Pp lt$@  $^/ AB%(0 0 u9@r9TP  0 0LX0'P 008 0 $ 0  ,008rP P P (/ /// 4$-L0L 0  M2/0P 0 0  Ѝ@S L@-P@0@0p0M3/0003/P `P @tNP )#HP  *ЍR 0/A-pPWP,t0@P` *P)@03/0 3/03/T03/03/00Q O- 3MPQ0`h 0 R@0 S0S` h0d gq0P` h2003/Ѝ@/o"#! `Ѝ|u d0PPr |0H0P2\@0T0D20X0<20L0420P0@HPdp$P @dhP` `l  @ PT0L0D0X0@ D0@0PF P0 RU RP RK h! Q@ Q; Q6 < ,<0v   8D$|40,( @J sU\@dIhPm 4Ph @||0 0p h ` X  P  H  4Q D $ O--P%\M@, 弨0,PP@h@ZP=0P%@,,PPP \Ѝ@;,P 5 050$P0 0Hp0P∀ !084P ;P)=0 iP"=P;0P P]PdPbP040"X040!084P "P =,Pe7"P,P:,Pm [,Py :0+,P$P:,P0h#,HP",HpP|U> [wpv S00%  pP. 1 C  R 00 0$0 00000 Y E6  X;S 0SUT P0~ Uy UtXP p/U,,DP6=0 "@,P/@~  P sP& 800"X<e]0. ,PP],P Y E6  X;S 0Sd T 0 H GP 80< 0C0$00$0 0 5\Ѝ00$0.Y E6  X;S 0Sڤ TY E6  X;S 0SP T $QDl0 O-@`Pp@Pp0S T 0S@ dt003/0 3/ 03/TP 0 S0,  (0G p@-P,@;c 0@0l03/0l8pF p@-P,@0c 0@0l03/0l8p|F @-`H0T0 M( `0S$ pp0 p00p0000S0S E6  X;S 0SL000S  Ѝ@-R Ѝ U@F X@-@0T0 M `pxQp00p0l00Cl000S 00 Ѝ80P03/(P ZI 03/HE @1p@-0P`8@SM% R" 0`C0p 3 p  p   0 R QE6  X;S 0Sڜ000SЍp@QE6  X;S 0SL000S<T _0TD Xp@-M(P:(RPp@@@^T (^ݍp d0 (0, H@P 0S0h0p@@@;T{ ${7P0h00 0 ,( Ը///0A-M0"x8 0P@pl`P H ``p00 0 0S? x80x8p`8(Q `p80l(0ᵝ`8Ph(`h ˞ PdhQ k E6  X;S 0Sڨ100S QW 10 S  Ѝq>0 Q`8` R ` %X\0N Ѝh80E&  X+R  Rڰ   RS"  SX P\ ` R `   h @007 Ph  A X$X,,p@-`0S@PM) R/ P E6  X;S 0S000SڴJSOPUx80x8GPx80x8h80Ѝpx(U x( ЍpT E6 +P> Xh`0Q C&  B- M0 Ѝ9`8S  /`8S p@-@M`|`p0PU Ѝp`(0 P<Ѝp/O-P0x003/PPe Tqnk (& /xv0p00`0t0 0t0 000&P >00= 00 -Pp0S{0 0 &00&T E6  X;S 0S00Sd- K0&0`0S" 'p(0 $QP ~)P3[S(0S0 `0Sh0l  0S Sh00l `0&0;0CcS7`)P&0S1 0 T E6  X;S 0S00S `K0S h.+t090! 500Sv; p0CcS 0 E6  X;S 0Sڀ+K Tp 0pP]0@,  $ ;/P Q[ J0 p&00 n00T E6  X;S 0S00Syp \:,p003/0 p, PE6  X;S 0S,0< Jp_ 0" 0 ,Q P. ~J, P p  nP'0 S: `0S +t0 ,0(0 0, P (P p *>P,P 0 E6 Z X;S 0ST00SPڰ( {JJ$00$0NW0 I$0 S0\< PZ  PT0 S S8 R 0`0,0   }I 0W} p 0`&0!(P p+  P 0'S\ x P 0P'SQ P wP 0BcSE6  X;S 0SI`0S  'Pl R p[PB T E6  X;S 0S|I 00 h0)c: 0' 0C'Y 0嬤0P04 0%0C?o20E6  X;S 0S 00Sڰ% 0 I  85 0 03/ R ;3J0`0&E  Q XQ QrIE6  X;S 0SdI$ xI0h,,0Pc %IM'P pV* [1S P8S ;S t00t0E6 0 X;S 0S0I0`0D ;H0 `0& 'P p8%30 0rPL t00t0 pHE6 p  X;S 0S00S,H%,& PH&P p Vt0D QG X;S 0SAڜH`0- Hp  -P? 0BcSE6  X;S 0SH1003/00+0  eHQT X;S 0SN00SJڌ! HD p0\0 0ӥP`< Pu000Cs0Sp0 Sm 0 Br0 Sh 000Cs Qc 0Aq P^ 0@p PYd10000;Ql& Lp0`X$hT$lp,x4l  /HE6 ! X;S 0S00T0  0fP E6  X;S 0SڐGt0 0t0(Q0Q E&  X+R  RS  R -4 M G  Ѝnk@-HM@  0P Ѝ 0I0Ѝ p@-PQ@ E6  X;S 0S T 00SH  G 000 9Pp0p@0/G-0M(@A0P03/0Pp0S 0S So0P%00 00C?o2 0 00Ѝ pЍ 01S0P, ( P0000 P50 0 0 P0 QP     ,P p0 0C0  0P0x QJR 8  00x|  000 0 /0@- MP@, 01 Ѝ0@-@0Q@M E&  X+R  R S  RP  0F00S 0\$  0Ѝ@/Ѝ @-`@M0 `@0p03/PP` 0`04\  `P ,Ѝ+$0003/ЍX Lp C-@ M@ PX\ p`@\$PP  R(000PQPX@\$P ЍC-0M0c`PXpQ@F  P  R 0僑  003/ 0P !G 00X0Q$@0Q0" 000"Q0! @U E6  X;S 0S 00S 0 +FЍ00 @Q T  @  0S <@T@ @00ЍQ0C-@M@08`X PR0 p  o0X  @T# 2\$p P 0S 0U E&  X+R  R  R   0 E 0ЍA-@@`X RPp P 0S0 03/PX @R$pA0 0/O-@X$Mp\@@ `pP 0P 0P8 0 9/P0 0 X@ T$`: p  $Ѝ PšXʡA-@MPp0`0R R R  0ЍP 0`80 ЍA/0ЍX^0 0^$ P \ P X 00G-`PX0pS P@P $X0PU:%?00#1l ?B!h`0d p@-@0Q@PM E&  X+`R  R  R 8000Ѝp@/$  0D0 p@-@QP E6  X;S 0S U 00SP  D00P0p003/p@{ꐾO-pX0SP`M@ T P DcX0PU$@:P2 @T'X E6  X;S 0S00S P Q p  0  dD 0 0000Ѝ 0 8@ 04/@TX E6  X;S 0S00S@  = 0  1DLO-04M0 0p04Ѝ`@0 PT7 0 R  pX R8 R X0S|8P < R  R00pU E6  X;S 0S00S 0 & C0 p0000 000 P 0S0 0s 0P p00S  U E6  X;S 0S00Sڐ% C0(   0},0 S0 S X0S00SU, E6  X;S 0S0q00 R U E6  X;S 0S 00Sڀ$40 ^C0L   08P0 S<0  SX 080>U E6  X;S 0S 00S#40 2C80 0 0P8 <p00SX0S  R S# <Q SU E  XQ Q  RS  RS 00<0Sp R 00'&< &zU E6  X;S 0S 00S{T"{ BC h0lP ` [d  P0 $ R$ S 0 G0%UL E& I X+R  RC  R?4 h!0 B6 0 8 $0 Q6 Q60?0AT@0  8!QE6  X;S 0S 00S,/0 @?P!P 0@_>{P  { {0T{8\@X0} Y 0"  0Y"P 0#000S000X0H0 0D400<0P0@0d0(0D0L0@P@(0Tw 8ppZ<<0S3 X0S) $0S0S# Q0PK P80,$0,  \82/@P80 0  P :/P0    0SX E6  X;S 0S00S0S. ;0U$ + + f>Z @qn`4 1 |0004 140lPTP0S 014000S PP (p% D`pQ000 0a=7nS@00@Ѝ 0S00 0S 0 `00000@T  p:$ P 0R0 03/@T@T 0S :$ 003/00 01L00qX E6  X;S 0S00S;0; xP(0S 0( ` D8p( X E& 0 @ 0@T 9$ P 0R0 |03/@T(P(q`0S  0S(0@L0XP(Pl(-0P 0P@0S( <0(4@ |P0PT0@X E6  X;S 0S00S' ^=[g <0(4@ ZP0PT0X E6  X;S 0S00SD' <=PU (0 PUD ( P(+P0 ST00S 0Z 0Rx 0 `0(0 0(0 0 @ 4/P* `0S `X E6  X;S 0S00SZ( X+R  R$  R ڴ% <P0   0S(0 0\0R0S `0Sa `X E6  40000V40!>Ⲑa 0c 0P"` 0D8pS n$ 4003/X$ E6 * X;S 0S$00S @ < X6 E6 , XKTs 0S& P @dX E6  X;SR 0SnXq E6 n X;S] 0Sbg< qn@`t# @c`30d0[ (0Pb`0\ E6 Z X;S 0ST00SP  (  "\0 <E\ P\0S(00(0K00Sڈ" 0 <00SP(00(0400S ZD^X E6  X;S 0S00S! ;Z X@ PE6  X+R  R  R=@TaZDZ[ P@TZ:Z 0SZ RL @TZ@T><04@n(qn` 0 L;@/ (p 0n0 00 ;@T"Z@LHx1|8PlܢTܢXhZ P@ `Z PE6qn@`p@-AR@PM RL RS Q E6  X;S 0SU 00S; Ѝp10`0 0 0h03/0P#  `  0[ P 0 0@ 1/0 3/ Ѝp  x Ѝp @00`00  :$00`TlLddP1p@-S@P` - P1T3/$p 0 2S R(0pppp@-P81B0@ \ P@ @80p@/100*p00p00CSAp0d 0C?o20Mp0000p00p1 C0C {P0p 0 S. 0s+ p@-P M0 @` 0#PI 0:1T E6  X;S 0S00S(! ?:00Ѝp/T E6  X;S 0S00S  $:ЍpT E6  X;S 0S00Sh  :T E6  X;S 0S00S  98TDțA-PM@ (1`Pp0P(1T E6  X+RQ 0S 00S!0P 91# Pލ PU UCT0 E6 - X;S 0SQP&00S(1  P!0 P9C?10100S Q(1  0 9QPލ00S 0 {9,U *9E6W  X;S 0S8Pó8P00S8(1  $ 0 U9ꈛLDA-P@BM` $P 9 !p P$1V E6  X;S 0S00S 60qBߍiPU U00sU0SQP,"UD 8W7P$1$ 000P 9Ș@-@ M~` 1Pp @ 0`  Ѝ0 0 0#U` E6  X;S 0S00S 0 80 0#U` E6  X;S 0S00Sڌ 0 80 0 0q#U` E6  X;S 0S00S 0 8ȗ$0@-@ MM  Q0P E&  X+R  R  Rh  0l8p 0S 00ۍЍ0NP0+ ` @-M@ 0 TPލE6  X;S 0Sځ,DT 8O-`खc>@0MZp܄䔖 0 Y00 0 0P+(P 0,0 0NPrY  [00P  0Sx ,巁E6  X;S 0S0@0 0 74 [ [ , P0Ӱ0?Ʋ00أ0  0 Xs@gTe E6  X; DS 0S 7?0 _P0HE6  X;S 0S  s7 101ߍY<00 0 0 "nPR Pq P Zz ; 0;@j,GxS|0 7 Y! 0X 0D(P E0,0?T@,jGUS0 6-ߍ0X 0ZT (P " [? 000f갰0b%P00$ 0 P 00$0S?0 0j$P1@0E6  X;S 0S  06Z"00ZE6 _ X;S 0SYt 6SZ !@j,GR40 6\TА @-M 00@0 lPjPPЍ0@-s M Q  R@P Q 0c0@ Ѝ0 R 0V 0$3/@ Ѝ00@-@PT M) 0s& Q E&  X+R  R  R  !\00!0"!  "0!0 !111000 Ѝ0  C60Џp@-0M@`xPQP E6  X;S 0S00S80003/00Ѝp  6 R sR p@-P`P@M E6  X;S 0S ,  R(0 5G܍p/ᰎ@-@cMt 01L0; cߍ p`  lP0 P@,QH0 |5 @,Q0 o50ԍO-P0M0`  00ߍ@H$pRL$  pzJ? r000P 00S QE6  X;S 0S00S {{nE&0  X+R  R  Rs E6 0 S X;S 0Sx75(  P p0 083pph E6  X;S 0S51 001 0 p0 60qp$ $ Pg$0 P 1 p01 A?  E6  X;S 0S 00S 0 ! 4H1S< 3 H1L3/P*U. */4)0 XAX}4 S X;S 0S00S! 4000 ,pP0 Z4U4  040. 0  40 ,pPP0 34i `0(x``4O-P@GME0P!R0;0 oP1`S0;0P `0sE6  X;S 0S00S^Gߍ  000 0P 0E& S k R X+R  Rh0 30 R? H1Sf ] H1L3/TY Y0S/ P1S PQ 1 R 01Z1  A?   d#0 3Gߍ RJ H!R    島 0  P P`ljR X+R  R0 30P1S P0`1N 1 R 011I`,aO40 @3`7F6H1Sl{#F6㔐0 PE6  X;S 0Sڪ0 A3*` 0 0 0 P900 0 P   0 PE6  X;S 0Ss0  3E6  X;S 0Sbp0 2E6  X;S 0SQ00 2ꨉtȆ|001A-@(M00s 0(ЍpP`}0P%0S9 U E6  X;S 0S 00Sp"0 2 0 000(Ѝ000/U E&  X+R  R  R! 0200 p` 101UR E6  X;S 0S00S0SP P10    ! w20S$ S 0$00 0)$0U E6  X;S 0S00S 0 @@ P20$00 0$00S Sr %PH00XH؃ G-0p0MX`0 @rP {{P PT 013PUA P1So0s>00ލPP0- 01 30 n80X E6  X;S 0S 00S0"0 01y 00Pލ 00EP Ao 0X0 0 E6  X;S 0S00Sڰ! 117000E6  X;S 0S}0 00,M4  0 ]1jX E6  X;S 0S00S  b1EM0 0 0XP ZE6  X;S 0S@ #1 #P$p܂0Āp@-@PG/ @  T0  T   R p   R dp  0@- R0P@ M R R    R d 0(00 Ѝ0 6 00 R Ao! !!! !   Rd  00 02h< Ѝ0@-0RM0\  \@ Rd @0a Ѝr -Q M  [  Ѝ/C-`1 M0@PpN P8 0iR7 0t1 0PP0=  0P0APC@ ! P 0S B IP!  @EyIP@#0003/@+ Ѝ fR !R R @_IP  R CTIP Ѝ R HIP(`@-@ M@ `0pG03/PP" ( Pd x0 @ 03/ 0 3/Ѝ<  +P 00ЍXLܼ@-@ M@ `0pG03/PP# ( Pd |0 @ 03/ 0 3/Ѝ@ < P 00ЍtL@-@ M@ `0pG03/PP# ( _Pd |0 @ 03/ 0 3/Ѝ@ x P 00ЍꌳLC-tQ$M`p 0MX!P G 2/@PK  0 0(01001 0P 0P03/ 0 3/ $Ѝ 0  60 !5V E6  X;S 0SQ 00S 0 , @@ /ꌲLdw08P/(  P/0S/P$ @-<^ ^x@^^\ Q RS  0S d /ܸ/@-M^ @0 @$E6 0 X;S 0S*0``8@ 4044/@PE6  X;S 0S0SA $! 03 0 `)@H ЍE6  X;S 0S 00Sڐ 0 )0h9)@@0p0X0,  ffep DcccDbA-p`P@ _0%P00SPpC-@` M| K@P  Ѝp 0@0@-PMU* @ RT" Ѝ08 \  ^ \  P @8P 05/P  0PЍ0O-@P M04 p`\P"0,[ 0 ;/P00S@T Ѝ0P @-M 00 08@4/P Ѝ/ @-0PM@ 0 80  0{CЍ( ,(, , (R /{{, ({@  @ Ѝ 0u%0{(, ( ,<  ,(Q,{({@R@ 0  Ѝ@e% C-,r`PpMR L@T 0  @H@TE @<0PS 0 J@000@0\ i0PB  101" $"E  P@0< 0R@0 0 ЍX P PP$D@TPЍ%Ѝ $00003/0P 0墲0  0 XhP0$ 003/P괇LOLG-pP > LPU   PHPU6 P<0`S@ 0 1@00@0 nhP @ @ 6/PTY 9/@ < Q@     DPU m$z$ A-PPMO L@T 0  @H@TG @n `V 0 p; @ p< R  O@  @ !1"DRE6P 0. S X;S 0S XA ! {{e#D0 W @0< 0R@0 0 #ЍD@T 0] 0S X;S 0S"\;#8 ( # 0ЍA#  LLPLKLKO-@4,M0P@0+ L`V 0  `H`V$ `8D R@ @1D @ < R  @ S @ [ @@0< 0R@0 0 ,ЍD`V@8#,Ѝ0 00@ lg0P0 @ @00 000PSp PW]Z`  ձ@PZ P `ӱ@P ͱ`nUP -U0Pp@PW `<  E6  X;S 0S1 00S B ᤱ 0" 80@c gP @ @08 0Sp0*f0aP0PS@]Y8k0@0[0P KP' 8]0@0 S":T@P' E6  X; S 0S 00S"`y" 8x00[@ 0"00HG@-PD`h1MSe L@T   @H@TK @00S G @ H< R    0"0@  @  R0pE  XQ Q!P0 0V0 00W @ < Q@    0"0D@T 0Ѝ Rp1FO-`P$MS LY 0  HYK <0S 0 D@000@0#P+ ffP" @fᅰ@T ᄰPჰ@nvTP 1@ f[P X@0< 0R@0 0  $ЍDY !"$ЍG-`P MA LY 0 @HY5 p<0S 0 >@0 0@0xfzfPP @ufP&@P &%@ ^TU@0< 0R@0 0  ЍDY  Ѝ p ! Ѝ !O-P M8 LpW   pHpWp0 `<0PS 0 3@00@0ffP0 @fʯ@T% ɯȯ"VU@@0< 0R@0 0  ЍD[ p _! Ѝ  G!XO-M@pPD? L`V   `H`V7 `P<0@S 0 :@00@0 e eP e0qZ p o(,U T  03/@0< 0R@0 0 ЍD`VXЍO   @-PP M' L@T   @H@T @< pR `   @00@07/@0< 0R@0 0  ЍD@T  0 Ѝ@/ 0 0 Ѝ@ C-PM] LpW 0  pHpWU p<0S 0 R@00@0.e0ePP @+ePܮ@P ܮۮ1@P@01UeeP @e@PT ᾮPὮ@nRP 1@ Y@0< 0R@0 0  ЍDpW : ЍCE p@- p@0Q@P E&  X+R  R  R,00p@0/  pDs,0@-0Q@P M E&  X+R  R  R  P   02/ Ѝ0@ Ѝ0  0?0(00?01S5 G-`Pp@P 0c 0S' S3 Sr SB S0SJ S 1T0  PD pP 0 0 0000 / P00P 0 1/  BRIAP 0 G6@-P 0 0S PᘷP  jP0S>6P00P 0 1PP P P 0100/qP =X9@-@`M0 ` @0P0p 3/0P 0  l @ p 0 P 00Ѝ0@ 003/ ЍoLw-Q M Q ЍP0h  0PD P$}PЍ    8C-u܅W0P@` M6Q& r> pW0pT E5q^TP0 @T00 W0 Ѝ Ѝ u܅W0 `T ЍR Q p u܅W0 `0@-S@0$M P R?%5R}.0!Q1$Ѝ0#$Ѝ0  0 1S 0@-1!S@0PM\0 1 T0Ѝ0/Ѝ0 Y 0!@!PC-q M0" P`@p1S V  0 000P 0Sp!0% 00SP Ѝ `!0 10/01S/P/p@-@`PP P PQ00•00p.0cP 0?s00p.0XP@@@La p . 0}\6'7sr @-M{NP 0 D QЍ/p@-@P<T 0D?o@ 2@ 1" R 021p@p@-M@ =0P 0/0ЍA-`PpO@M0 i011 R @Ѝ!L R (  @P h  0 0J@P00S00 00/gL0 000/f//p@-Ptt0tI 0`8 8<0P00p0 R (=p101p@-Pxxx I `80/ 8<P00p0 R (=p|0H0d00S/@-)M@ P0  0 R 80  Ѝ00//0S/@-)M@ P0  0 R 80  Ѝ004/@/0@-@0 S1! B0CR M0 S R Ѝ0 0R P0~P0 S0  Ѝ00 Ѝ00 R R=0 M .(.O-M 00`YCSQF0 000$09(0⪿(0P   S R@<1@0T@ 0 R, x0SE=0 0[  R  Ѝ0S:"P3000000S0Ѝ09c0 0 0 06 P  0R  0 0000000 R $ 0-,++0@-@ M@^@TP0S S  Ѝ0 Ѝ0@ ɁP Ѝ0@R 嬿0@ Ѝ0@-^Ɂ00S @09@ @G-0`@pP`@0iPPP@TU Y0000 U(ttPt@`lpP@@T CPp@T@H(+7Z**64Z, @-BM^ Bߍ@x @   =Bߍ)0O-PҼX>X08 ,0LpDP4`<;ሼP1 `P={PT-  P  $0(0P=X0X`V-  R*L ,~PD  PD  V hP T= X`(0T3/X,  n/P( 0,3/( P,PቹD0P0P0D0\Pa0p SD  9P  2P< hP 03/P(b 03/P,\ \D0(0 D0SP 0S4L D00D0XG  \"0P S 18\7 18\pP-PP \P0 Spp.P  8 P D00D0W \p0 S .P$ D0  4 R  D0[01D0303@0 0PP p ᏤPP ቤ P 寻P00P Q -P ,Y ,[ D0 D0 ?? W  呻P00P~ Q} Pz D0D 0#u,P ,Qq Pn ,,0o?o2PfD0D0 @ pPW 6P@0@0~0 ร4 0 E6  X;S 0SX ( 0أ(x00$X9 #^ R#3Ѝ S N ( RK /QH REC4 RF8 < B:Qh WQXpL +PD0 0D0-$$303#! P ۷PD  D P](0S 6 `03/X  -0X` $T3/V`Ć- $PQ 0S.0S+ S S S R 0 E6  X;S 0S<0^ (`಺P 0S404D00D00S0S S S S R  X T固P 0 E6  X;S 0ST0"DzP\ XXY T`0.S X  .wP @HX䄟n``܀VTXy 0P P @40003/Zt ,-P0V VD00D0j!-P(K P,G XE \!0p S0Q CPDP X0S T08\0 \"R0\0 1ι Pq Rc  $0x88\00S< 7;S 0#.""Ϡ !, ` B 0S"!"0/  0"!/C1" P01"?!<08 l໹PU D00D00SR >  P 0 E6  X;S 0S000 =00 ?oR20S4`<(0 ?oR20S 0S 0 0000 E6  X;S 0SL 0X0 @1,003/P$vy(0S/ P B hP 0S Y_`PLx@l DLtHL$pDl8 } PA XX> #0OXS9` T\H`倸 \`HPH0| S0880Q/< #8gkVƏ `< 0㤻`V8`<  P^ TX0Q "4 0 E6  X;S 0Sd! i T`XI/P. 0A+P( ;P," 1003/P0T^T`XG 28 R 1#807;8<0 81 ?CR0 /0000 E6  X;S 0Sڤ0T $0n 0#G-`R p(MM 4 00W4@ X; 0S8 -SS RP140Y4* @|nP0" 0P P  < P 0 00勸 TZ ί; 0;404(Ѝ0003/`P @?^@,T 1 tP 404E6  X;S 0S, =H4 L  p@-T[Up @3PU B6P&3aPPE6  X;<S 0S YPUp@"H 1L0  /P@-@P 8P $o  O-P$M`p]@P:p ̲0够X  2P$ЍC'P 200P  U  1P U0 0/S, Pz D @000#0s0S 0PU  0SZ ᨷP ,[ ὶPP 00/S崶  nXPE6  X;S 0S( 1003/PP8 ῟`E@Pp Ὗ἟@P0 0ಳ ᒟ@  @8T0003/$Ѝj PD00PX  lU9dP/hG-`Pp?s@PT pPo80< 0@ 43T0C3pW< 0P /- M0 ;  0 Ѝ/h6 G-p00PP" 3S M`P/@P /00S }PP P `#@P?X>`0003/16 O-4sMSpP` 0P$Y@00 < 0-SS 0 Z*@P0D Q(300P BP )0@S03/E6  X;S 0SDϲ0 0S L0PFS 0S T P2003/0P6ЍOO=0S200 0AQG 1003/P00d @? z`P z00 R1@u`PYx1  0hTK D1` PLQJP d` 03/V P 0 P3/0 S R. @w003/S j P0 3/0SR t0003/P @<0T00 00@5D LL!0R 0@-0PMU +@!" 05/0! !Ѝ0! !/ {^΀ { 0!0Pp@-0@QM  ! !ЍpP0P0"R0 P0) R00Ѝp R  00`"R   V0vP0  00``0@- @ PM F6 0 00F&P Ѝ0    /  Ѝ0A-P0@0p`پ13Q100 tT E6  X;S 0S<000SA蝾  sA蕾.dA-D0qSpP`@M d@T@᛾> RD 0X 0IE6  X;S 0SH100S ڤ1?,! {${8UDP  sGDP E6  X;S 0Sڔ000SЍA{X 1 Ѝ0S4  , DЍA]-p@-M`Pᰜ@P' U0 ᭜@P 00γP᠜Pl  ᆱ F6  X   ЍpЍp   O-$M`vdQ@PP1 X E6 5`pY(  000P 00S`pT \@ V P0S  T0$Ѝ X;S 0ST000S,< _  0 $Ѝ*P D0S/ W0@-@0v000P DP/Pp@- DPPp`@P P00PP@Pp1A-00PD`Qd@MDh0S C Up"W PT E6  X;S 0S<100S " ᫛  ЍT E6  X;S 0S000S( ЍAW 力 P:T E6  X;S 0S T000S D 0 " (4r0+ h\' @-M`pPP@P. U N@P' H 0U 0 0R 0 Ѝ@0塼 PြU0ЍO-$M@pPHPL ?@PD `@P>  w  V[ P  @ B 0S  03 10 0 S0P 0 0S  03 10 '$ЍC-$M@P὚P& ᷚ@P# ᷚ@P ᱚ`  <`V {រ@P$ЍA- M@pቚP) ლPP  @PPP y@ @ǻT  Ѝ@ Ѝ 3O-00@Q00SCM00CߍE6`  X;S 0S ڨ200S: 0l E6  X;S 0SH200SxP P 01F6Q P7 PJ   QPU (` lP e+ dE6  X;S 0Sd100S X pᲙ ٙPP!  Q00CߍR/?34E6  X;S 0Sڌ000Sڄ E6  X;S 0S@000S< <  ( qt"$l00p@-@P0p P@03/Tp<O-P0M0 0d밁`PK @Tp`_ S` 0S ?o2QP!P3U @T+ P %0S` 1/P)  0 `PP0[Y@ WT p `P Y Ѝ ܯ PP Y 80@ 03/Y ``C-qPp M< PP5`@ Ư000!3/pP%  壯 VP`  `P /` P Ѝ ` Ѝp ЍPLp@-@M` ⛬P  ╬PЍp0  Ѝp0 ЍpG-`0`0p03/@P P 00RW lR Y0 PP0#"7 0003/P@tL//p/RQ @- ܫPP/A-Mp`׭PP  P@0T S ԬP  @P@PЍ00S S Ѝ< ԭoЍ ˭o433p@-@PP`kPD@P.ܯP@p@-@P`s0pS&Qb a2,2Œ!|.#wps0 4r DuPM8H<L 0@vˮЍ@-P`pM  0)  0! 0 Ѝ@-M`PᅮP@1@#  }! d\@㙬@  00 Ѝ@- MpP]@ P@# 0 00 3/ `P0G 0SCCCl 0P000  2/0 Ѝ<0 0403/`P 0 Ѝ@O-aSQ``M:P0 0 0@ 3/pP, T K   [I`U 00CP Q AAh 0 8 <    XP@80003/Ѝ@ЍzHO-\M@`D05!1PԱ @́@D14s0"c#b!!3c d0320"T |1 p00p03/PP`A 0+,@@@ @@@ 8 {(4 {$0 *,( z($ z$ !{z0 ,; 0 $0 R' 0 0 0 (0H@@0@ @ 0O`P  0D0 P0p\ЍH0003/\Ѝ,CnI-1LG-P0M` 0 ddp @  @OP  0 0 00Ѝ; pQ p@-M 1PN-`8P 1CP  | xЍp 0'/!ЍpV0  S0S rs 0 p0t  sp0t @-0P0p0M0`3/@P02Ѝ0=SS0  d@P00 0,0@-L@H! MP   R ^TP E6  X;S 0S  Ѝ0@PU;S" Ѝ0SP E6  X;S 0SڄE6  X;S 0SX0 vE6  X;S 0STT,0@-0`2M@Ѝpᏸ0P ፸0P sၸPး 0 W0P@800 0^ XG-`pPP@T ᗬP Y@T 0AC0 CQ R-S_S  `Q00`010`01t0@-@RM 0 0 0Pd P 00Ѝ0 PЍ0 0S08200Q000/ 000@  \@0 R= 00/\RS/R;S0 /A-@P0 0HM1 0$咩04`0; 0@厷0 000,0 28 R PW  44,0(00!@0S!(00囷P @00Sd@0S0 0(3/P@00偷"P00S@HЍ Qd0( ,000F6@ j@P(0S lPU2 R# @VT5RSp 2 (}  20 0(00 ,00!F6@ 0i@(٪p)00P0  ,0(!0F6@  0 `ur@ 1,0(00!V&pP  4pS00 0p0 @ @0(!0F6@ rP0@0V  0`p@f 0 ,00(!0F6@ 0 Pr@Q t00(00,!F6@ 0 h@;Rl 2Rh|$4lO-@ᔔ0Y0 X;S 0S,100S?`@X !0 @dW Y& 0 @d((,80P ;00C0 8E6 0 ۍ Ѝ`P 0 c@d`H@d@... xE /G-@1@SpM$ E6  X;S 0S ڔ100S00 X0#S70 @0; P ;  00E6   ލ0@ Ѝ/ 娤; 0;P/--E6M  XQ 0S0   Ѝ Ѝ/P/ --E6M  Xː\ 0SQ 0S 0  0 ЍЍ/P/001H/tP/001/$5\P/--E6M  X;S 0S|00 0S 0S  0SP  L0 nЍ Ѝ/  1 84G-PM⌎@P' kppሎ`ᇎU@ E6  X;S 0S 0S 0XS ᴦ< TЍ  1H0|P/--E6M  X;S 0SP0SЍ Ѝ/0   Ѝ Ѝ/|P/--E6M  X;S 0SP0SЍ Ѝ/0   Ѝ Ѝ/P/--E6M  X;S 0SP$0SЍ Ѝ/0   Ѝ Ѝ/TP/--E6M  X;S 0SP,0SЍ Ѝ/0   (Ѝ Ѝ/P/--E6M  X;S 0SP40SЍ Ѝ/0   0qЍ Ѝ/,P/--E6M  X;S 0SP<0SЍ Ѝ/0   8LЍ Ѝ/P/--E6M  X;S 0SPD0SЍ Ѝ/0   @'Ѝ Ѝ/Ph C-q封少Mp ,0 ɣ@P#00-S4 +S6 @zP 0L!0 S@410@ @@@$@,@4@<@D@,P ЍZP & QP {w?P  `5P L009/3T<`LY/0/A-@`M 010p40`P 00 ,5/P T E6  U! uR 00S9# ЍX;S 0S(100S(0S4 100 PcU01T0 000E6  X;S 0Sڜ000S-PQЍx00 )ЍX"H00@/00 L@LO-$MHPL@Pp8R`R8,! 1R/ R0 (!R- Z1, T 0 X  T1# 0 PGP 0 @T P 0 $ЍS (!R@@P *O-@T $M, 0 P$ R \! \ 0 0P 0S  R⸡P R ⱡPP, 0$Ѝ  嚡p⣡ 0 pcPQP0PUSQ0⌡U @20P $0003/P 000 0/0@-@P0M }0P0Ѝ00/ R HP  0 ݠ1/ 0R HO-頑 M`Q p0 E6 .@TK P*@PTPUD@T 0H?o 2R0SP 1003/@P7 P噠00@  ЍOРX;S 0Sڤ000S@T P@PT#h 0 @T PU8d Ѝ ЍPhLȼмA-`@0@0T0 pP@U03/T@C-p1`00@SpM 0S <0 080cPP+ Ѝ0 PP*0S< 0 8     RPQPP0< S *8 B 0 ;PP PЍ0 PP 0@0T0 80p@03/T@ЍPp@-@ `0P3M0ЍpE& R     ` 0zP 0  ` nЍp@-P0@-0 M0P@{0P% T E&  X+R  R x   Rh00   0P Ѝ0  Ѝ0@u Ѝ00p@-0`@D0PP T E6  X;S 0SP000S@Ppp@ Fp0/O-PM`pW p [ "PW@0Su@0S c0P$ G 0S   X#0Vp E6  X;S 0SH100S p00$0 00Ox0W0C00☪P X P0003/000SЍ 0eVp0 E&  X+R  R<   R4$0p @(XO-,M`PP P  P 0 00p0-0S3  Uz p0 V@ E6  X;S 0S `2 00SL0 @TPU P OPp0Sp @,Ѝ$0 0p>1(003/@PU $E p0 Ⴉ00 @ 07@V E6  X;S 0S(100S @0 00 0$ sT$0 PU  0P$0 $0 S0(003/@P $p L $0@@,Ѝ @PIp1z# SLtA-`@0@0T0 pP@:03/T@ @-@P@xHp@-@M 岝0S ``  P0S S S"S'S  \S R   ԝP Ѝp Ѝp'-G-M8`4 儞뜐P " 00מP@p 0 10S @DP0 p#'P ,0003/ ЍG Ѝ/DC- p0M pP  lSOp  Y0S . i@P pD0G ^0@>S@8 B0Sp 00Cp  $1UP@PN p/P . .僛 Қp% 2/Ѝ0 $1H  -,5 0 X;ۛ 0PR% ћ 0PR$ Ǜ 0PR ᾛ 0PR  嵛 0PR$!< 嬛 0PR!X 壛 0PR  嚛 0PR  呛 0PRL  创 0PR R 300R  x 0PRrE6  X;S 0S0SF6  c ` 0PRZH&Q"!  U 0PROH&@"!  J 0PRDH&""  ? 0PR9|$R  4 0PR.%R  ) 0PR#x$R \  0PR$R 4  0PR 3a#R   0PR#R   0PR@!R   0PR R   0PRp%R ` ٚ 0PR# К 01, 0 P"8 P <0 , ) 寚 0PRB   奚 0PR ,8L LX'' +N''''t'5'Q'uq''N}'~No':(@-H0@R0M 0EP 000Ѝ@/Ѝ@-dX MU D0S @`q 0D1P P Dәe,V00 Ѝ`C-dXaU`@pM  1d003/0 d8x8p(0x81t003/Pl2 d1D003/PPd( 0<00,0 !1 !l(0@ p(< 0PD0 0`5P80X080 t@P00 0Ѝ00D0 0`5mP dXU oⲘ Ⱈ40d003/0d8Ѝ80080L t O-@h8 0x80x82SP2PU`dXU`   P6d003/0d8Q0 $`@2SHPϖ2PU`ߍ@ ^: (`04PU'UUP$0s0MP^: $R<^: R2/U P"^:  ^:Sy Sb S QQ/10120200Cs0S0^`PU _ 0Q ?SX ^<:S  ^*6t`PL0 ,0  Ys Е,,4 0X@E  D  Wᡗ`V 0K@P 0E6  0X;S 0Sڰ, R[QPQ 100 DP 02022S  2,0p`p# 8 <4Yc R ?XX jPIPY: /PE`V0,`0p4PYB T?\P ^*`0` ^: PE^ 0uP :^: Č ^:UYPU? _ 0Q% ?S ^:S!  ^* 8P 0,`0p4u0s,`0p4mX10P10 ^b: PE^ 0uP [:^Y: Č ^S:U ^%$0S 2S"R 0eU@,`0p4U 7 0`7 <0p4, 0`. 0,00(XTНxQ8$L A\da`0@-dHP T M P : 8 0d003/0d8 Ѝ080 !0000/p@-@l0P0  R PP `03/0PS$ `03/00000p謷0X SA- P @`<0p 2/0 a@R000(//0S0/A-^ `pP@@^01\ 妓P@^0@-@M Ѝ@O- a\` M \90@P \2@l1 0 3/pP$ 00  ѕ  0 ʕ00 090 R* q000 Ѝ0003/ Ѝ 0R  02/0P0 Q  0!ᚕL  2/000 S0! L0@-PM@ 叕ጕ0  }Ѝ0RQŸ } G-@0 Q QM& : P+ 0A p 0Sl SaP P P `C  CؕP `@0  `HЍQ  R R 0S@+Ѝ ổP AQ      0#03/PЍ @Z p [P@WET $qpw 20 03/P  r/7<3S<3:Q7'0 077'0 07P6TS ; GT P RPT P L10 03/P ;0; P 10 03/P ;0;Q PX6S sPX dQ T6S =PTt h%R @T@D00ЍB6P&3PP_uPX0@-@PM 0 R ЍhPT0R0F>080 8-# ⚏2$-f┏v,0' '}.{.788<8@8D8H8L8P8T8i00ЍXA-@PM= p1 R90S6 PӠp%P0`P [40PX Q40P0P0D R ᘯ0SW 㗠Ѝ+PЍU00S ;DP ṲP WP DȢP0 U*P@-@PM ^ +Ѝp`PnP]B6  p 0S p0 Ѝ8 mL}@} -0PM  B& 0p0  R Ѝ@Ѝ F+Ѝ~||0@-@PM ! PB  0p 0Q Ѝ0P]Ѝ0  0 0+Ѝ0K{{p@-M0P  X@ T +Ѝp@`P0֟P] 0  00Ѝp0P D Q +/- M0彟P Ѝ] Ѝ//@-p M`P@0 PP.P Ѝ 5/ Ѝ@-@M PЍ@f.@-@M PЍ@.P.p@-0 0@`PP 0S PĐP ph 0S 0PS 0S 0S Pp@ 0 0S PꈝY(H0P0 < 0P/ Q //Ȝ0 0P  P/P/0/p?oC-2Dq?pM3RP@9  @D* P9S'/S- CR  #0 0SPT$ 0_S0 zS`S  BP ЍA CR~SQPP40400ЍC/MЍ$dFx G-q@Qp`P J01@003/PI T6 HHoo% 0T% C/o" RP@D  0A0C0B XS00 AH0C YX)܀P@D000S0 X02s0S  RS  RT00Z000@0X0003/PP@D(0003/00谚p@-@QRM\@ @ЍpP0`00 w0PU@ P 0 0  2/ @Ѝp]ܘ0 }0 000/$QSP p@-t\Sp@X0 P0@`DAl P^&ࠃB` ࠓB p| 0 00!" 0 0/`xO-`GM@S0wPPp0[ ;` p 0: Sp:F S䠝  ZP'P `0` R`P Gߍ`P|jx*V8R0X0<Xppt0W00p0W00+0Sa 0 0: S( 0 00  QP` 0`P%0: S  ` P` Y B' W060<0PO 0 K pW_0 P#P *`0`/Ď0P+0 0S x:|*0LL`$o0P*:sr |:*S0 ,`P5+0SPp400`0+ 0$`00 ,pP4Z 0  `, S 0S` 0  ᏍPp0 `|P PT *` Ὃ,Gߍ#0 `P,4┵`P'L0S  CH0v> 0014 D 8 ` < # !P @ l# 0` V`PH#0 N`P 0 0 <6S P` `!+00#P00SsP$`wPJ 0 ` H~S Y `Gߍ%` ↍Pr. H?[u 00 0x*`|j$` `pPa0.S<ᢊP5P00P*0 440{P `l  0x*|j<6S P| 7$`7`! `P჌ 0 P 0P ` Ɋd SPN`:`$AA=t($X~ @-L0L 0 @ 2/ P (0(0PL$}p@-@H0H 0P03/00p0 000p@/ᨎ@-tMh@0P@ \ 0  2/ 0 p Ѝ` 0 ЍH}<@-tMh@0P@ \ 0  2/ 0 p Ѝ= 0 Ѝ|C-h1P0X1M0p`@P Q 00Ѝ00 0 P0  050P  0003/Ѝg 0 p2/ 0 s000 +! `*x@P 03/p ۉ00%0| {0 0 h /ᴋL@ 0P /-X M0   0 Ѝ/ጋC-P`(Mp`@݋Pw hHp X0: S ЍS) ` P 0P0 3/ Ѝ `lȉ# P 0s/Q  R0s/Q2 BRP6`P2  P 2/0S& X -㶉p`0 0݇0P0Ar0 ÉPT ༉P (0P0 0 P0p4zy2,RQ0@-`@ M@ PP@ y,  @ 2/ Ѝ0 Ѝ0@mԈO-$M`0呉܂pP$ 'oY \k 200$0S ሇ@P P  $ЍjpPp Ps@P PQ P $0SI (# ?3 0-SD0SA! 00 0001000UP(0Q,Q# $0S@ ?o2$PU  R[00SZ   R 倇P,Q0JP@ 0  00  \(0Q0|Pw jᖆHHO-02`P04M "@$p`Wz @P$p@Wk $P(@`$PpU] ``p@$pPWM P$@pT? ppP$@pT2 0PP`pp$@PT 0$ @R $ P ,0 ,0 !1/ 0R03/T 2/U0 `pP03/W p03/W @P03/Up `03/W$P(@03/T @`03/Vz4ЍP-O-鸚M@@:@ 080 03/P@W p P`p V00SR Sp`L 0CS00 p@: `P50 03/50P050s0 03/50P050s0 03/50P050s0 0$3/50$P0500`V 003/[T<00S 0<0pЍO Ѝ/p0S @400400S W(X @400400SWX @$0WSx8003/P$ 50050uX qX m0SW000WS 40 X 7003/0P 008 2/P0 00400000050P050@40 WX X7003/P 4004050050*Wh0p0|W`V @"40W<<40W@@ !j40@040(0SyWFX @([W,02Sk0,0S 0SeW70 0K0WS1 40X Xe 6003/0Pn 008 2/P0L 00400000050P0504000400S5WX? @00PU X7 @ ` pdQP   R  R Uw X  OP$4 koPU Q‡Pd 5  5 X[P U RXᮇ@ 2/PO {  ,  { 4 q($(Z,0N $$$0[ R`P  4 Q P_ QP>PP @# 2/P 5 P U5 4 k X Z 2@.4 MP 5  5 4 ku Wpppkl U \VQP QI MQ RE$PV R4R\%S8,XA SX= ( X6 \1003/P> 50050X( $1003/P0 40040500500@ 0p@p0@003/p@px0@d0p@P0 @ <000@ p0@{LL-4jA-@M8M`pv|{T 0 @P {ݍ8Ѝ0p  jP@*0^ @P  T ^7/P @T*@g0p@-`P0px P@$`(0 X0 3/03/0,3/03/Vp03/(0Dw@-@M 0{ R  0Ѝ@Ѝp@-@PD0D 0`l03/0hlPP3/0pdPhP3/pPpTv@-<0<0@M0 3/ 0Ѝ@/up@-@ p0PR0P@pE  XQ Q000S 0 0!1 ucte0@-PL@ M(P 0 G0?o20 Ѝ0Tep@-0P0@M`(0P* E&  X+R  Rڔ   Rʮ\  Ѝp@訯 0 Ѝp<  !0 0 0ЍptdDbLdp@-P$@(Pp p@cA-1p0PMz(l@_PT000  `֭0P/o"  E&  X+R  R   R,ЍQ R! !  E&  X+R  Rڀ   Rp  !d0`00 08  !,0Q0|scc`bP`b-0P0 M E&  X+R  R X 00SH0 D0!+  Ѝq_(bA-`p'P@PP* 0 0H000L00!P 0 P101ṭ 0 '0?o20XatF-SM 000C SЍ000C S000C S0 S0$ ⼄P0 0@-0<#M@P p(P,` E <@D   P  RP`x |ʔ V vu@ \`U PU `P`Pf E6x |ʔ X;S 0Sl 0Mx |ʔP" ভPPh ЍXQ Q  RWe ! ! 0\ 0E&  X+R Q0ڬ 0 0P`!d0 pPP" Ѝp U@ x |ʄP`P 0 E& 0  X+R  R 0 0P Ѝ Ѝ?Px  p 0P`$P|L 0P`o@`L`\___^]]]]0@-@ M0S010 0 0S 0P  Ѝ0 P0zT0 E&  X+R  R0x0890]0@-1@P M 1 1 T E6  X;S 0Sڨ Y 101<x0x 0 ੬0P  Ѝ0 0,0 Ѝ00\\8<\O-xʐ|*MPp M9 SI \ 41SQ @႒*@ Hh1/`xVA Vr`x |: ʕ P#  ,~PE@ :㫂PP< 0)PJPہPH PPX( tP 1Xp x0 0^p9ត "00^P P  PP pPP0 IH0*P P 8~P  I2,  ,0P0L0X D0(0(0 ᲪPE6  J# R H :I04 p$?0J DP cP00S E6  X;S 0S ,^cL0 0 $ H0āP4pH bP PvpwpW<L0S ,}'1 C6310 18 H$L4R 0&喏D r cݍЍ,^ L0SL0S II'00 X;S 0So6 00Si R 5 0!] {L0S ,'X=,^ ,^l \L0Sp]qPPE PP፮Pz Ist =L0Sce0Z-0yP P0U03P30U 004H:0D IH0PE6  X;S 0S(4 00S  R 4 0!0bD_~PPE6  X;S 0Sڨ3 00S  R 3 0!0B/ #1!  01  "P00SZ0Z P Qk QN \PQMP PR .R,   R #$ "s0 u}2"0P0 .PPP0 P(0 pPPL0=S0D00!P ]OPUN,^ Q2 P P! ,^0 aL0S Q8 P pS ,%P,^,  ?s001 !0 0 ¨pP | ,L0S ,%p  ? s0  1v| L0SeLUT`SNDSRSdRRLQLQ(QNLDOO4 OOK|KNp@-1@P0`M E&  X+R  R 00S 0IPP0S 0#S ( P0 0P0ЍpD> ϶ YMO-|M`8P!PL ( x0AS%U5 0S0 0  !@P pT0PEPU`0" 0 S 000 0 0P000 8PЍOp0 P Ѝ \ @00 08Ѝ0 8I4-H0P M R 0j0000 Ѝ/4WG-0@M00t00h0Sp  0h `PP4hSm SP. /$P /PPUx*Ub 2003/Pl  EP/  P0 BSPEQ00rP/~PP> 42003/Pl 0ES0300`P00SdP. 000P4S7 01@0M U   }  B0I?oX20SSЍ0S 00S/S X P0SdP0d0[P  RP`0/S 01@%E6  X;S 0Sڴ000ЍtQ    x} `XЍtP i}PzP`VLHH(HG-TrT2p@`0M3/PP $2$ 0Py03/@Ps 101 0! 0PgP 1003/PX_ P 1003/P\G xu|P0 00AP4 DP. ;@0;0 00!0 ):60R40E6  X;S 0S 000S  !0+ЍL?|P;0;;@0;l  X 2/X0 X0  ,SLXCB8G?xF0@-0PS@ Md0S  0P  Ѝ0 Ѝ0@S d0S L 0 0P 0s0 0l08:|>0@-P L McR0-P\@ 0C S*0 E&  X+R  Rڌ 0T 0  Ѝ0@  Ѝ0@ , Ѝ0  Ѝ0@=X=SA-I@A@x0MSpP ` p 0 0P Ѝ 0 0x@Ѝ 0  `ЍA@=0@-@0 M d@T KxP@I@A@U ;#30 Ѝ0  Ѝ0@=C6<6S d0S @-L M @80P Ѝ 00Ѝ<p@-M @PT` SX4Q S 00Ѝp T S\4> S # 3 @D0Tm@ ST4Sb P  R0S  R0S S N 0 *R  0 p" ݢ0P  0f 0ЍpSS R Ѝp@0 Ѝp@&0S])srNF&d0+@V ! 壢0P" 0,000 !0@ `0S P h /P ! 偢0P Ѝp@/P h l00  i0P 00ް ${{k0 6D  L0Ps 00mP4D98x3p@-P @R`MC63"D6' d0S( +  &PU Ѝp  0PЍpЍp@l  P Ѝp@4S @  P;300008|7<7p2\20@-0@1P M 0 ߡ0P  Ѝ0`0` 0 ա0P 0^0 Ѝ0 0U0 Ѝ06- O-0M0TE&b `@ X+R  R"  RpTpp `p0000S  eP0`P~0'wPWQ P%  %P  $PPs0 00 y0!@0P;S0& Ua R0vP p?v0P o0P  `PPK P *PЍE& `  X+R  R   PP  P E&  X+R  Rڴ   R0  iPx yЍP ` `PЍw 4 f8P/>4D4333@-00`0@MPp}vP`@0St E6  X;S 0Sl@0S` P E6P  X;S 0Sژ TU3 Ѝ@vD0 000C S000C S000C S0` S P0!^wP0 0C0E6  X;S 0S Ѝ v03SE6  X;S 0St   0 p  3321G-4p0M@P0PU0  0+ 0`S  0 0P  r R 0S 0SE0 -;^ ; #30u0P ЍX R  Ѝ0  0P/o"  00Ѝ0 ǥ0P0Sv 0 00X0P00 90 00E6  X;S 0S100S! !0 0!Pt0S0ե00ť;3.d0SH ; #300S0 ឞ 0/o"  0&Pe 0 ጞ 0    0 m\4S d0S0 0z0PYt0 00P\4S0S0 0PA9P)h)(%/O-4:p00@,MP0PU0] 0) 00`0$ 0P ,Ѝ$C0P;I W0P 0& 0㇭ 0+ 0Ꭽ0 ~000E6  X;S 0S 900S8 0!0 0000 0000P  06 00,Ѝ;p80 0 0 S00  ȝ /o" HE&0P  0=RC X+R Q7QQ2 R  Rڜ'  RSX, >0P0Sj000$ 0 0[0S 3/00; 00S`0MRJ X+R Q& ! 0 0 R E&  X+0S  0P 0 05S N53/H00]]]P00 0k 0(   P0 0[]PW0 0; 00SN0 ;/ 0Mu0P  R x% 0 2/P  00  D5 003/P P 5 00P4 S0P4'0P003/ 0P} (1040(110E6A  X;S 0Sڀb 0SI 0p00s]v]0D r0P ,$ 0 2/000E6  X;S 0S0 75SY ᛃ50G]0 3/ፃ0S SCE6  X;S 0S0H 0 0QS R S0SB 10100 "P 2/0 P02/    0R  + R00S80@!) s0P\\\P0 R S FQ  01/ 0 0P0  0S0 0; 00S0\!0P0  0 6 0R. P* X0+ Rr ! ! 0 0S0SBa  ! 0 0j 0SM 0I 0+ RG P 04,%D%/!,*Lhp' d'&%|$O-85`p,0M2@0PT,0P( 0S!` ,0 00 傜0P@`  4R UR 0Cx40"P1  PЍ84+RE6  X;S 0S  PR0S 0  P0 UP{0 {q R 3R X004 Xe x:| 0PX(3 R P3R 0BcSSR 4S " PP0 00{}RR0070 &!X0 @SF&PS 5p `0Rt0dIRE& & XQ Q[!X E  X;S 0S&K므&(C63 00ⅡPPC00SE6  X;S 0SD. 0 00P'P"R#00C63P BcR0SE6P  X;S 0Sڄ 101 PR CPT*d!^K,H$$#" T&N0d x|` t td$ HR V E6  X;S 0S000S1 0! BcR296Sh 0Se Rbl 0C!09&h B/o" ! ҚPPt \o0BcS0CS  Ol0LhA"10 屚PS42R, 8VJ E6 G X;S 0SAp200S<ڌ2 0!a3R* V+ E6 ( X;S 0S"200S2 0!B BcR:60S0! 01R4S T3T#0 \PP }RX3#0 LPP R  PR  Rw:6S 1 0Sk $ +PP0 00R D4R V E6  X;S 0Sx<6S +RuDQrS R P@Q94RR, 0SP:6S@P:6 %SP0C0 PP lV E6  X;S 0Stj W0S 101000` 0 S iPTSG!XR 003FPA464&0 PP: "5E6  X;S 0Sڀ#000 P   0UPP`0SO 0 00TP0n0 S0 S  0A60PpP `pPp7003/pV1 E6 . X;S 0S(ڴ#:6Sd1a00Q$RR 8 01 (0 PP 0n $ o PH$ 00@ 00C10@0L\ Ppp 0 00C10N^p000C10H⃀;Xp000C10I0<SpW0Aq0Ap 000G0 B1 p0P)P1  m/ ᄗo0 d0S C6#1 0|0P-H0D S0v.  0 0C 4 1 8 @ * p ! < $* lE0 Ep 8E&0P E&s P#0n m0 R R 0 RR "R R p P` 0"S mPR `Rv "R@  m@<;<+0 FP RT tPX500S + ,PP PD (oP`P  @` 0P S @` 0R00C SU B2*0` R B0A QU: 1 0nP 0X# 0R$ B/o"aPP _0 00fPPP` @ mV E6 1 X;S 0S* j Wy P6aP  0圝PPZ!0  S!  - ગPPL0 001Dl h-0 咗P4S 2P+Q'ƱE@ ( {P{ X P PʻCPX004N pPE6 0E&!0 wPE6PP00E6> 4Sg # CPP ps P"0 okE0 Ep عE6PP00E6#៥0S d0S \"0 PP Q'Ʊp `0Rt0d2E Q XQ: Q7J d1 "XRPNPQ'!d0 PP" l0S l! ӖPPu0 00ZmPh 10/P_)PY 02 { {PM' 0 0 0 10 P2 LP, b8T &H  ,Dp <    ( d   $x tT PP0 0 Md0 0P 2/ p0P R2E6  X;S 0S 00<0  R) R PP ,00$Ѝgg= 0R   00S0p iP 00U=0 P P HX g000C S0000S  S  S0 [S 0C0000`V V0 [00 00 C hP 0!` 80@080  0 0R0 R [  iP S [gg0S S0 Q00 0A QyW0 0Tgf0S Si0 Q00d 00 C0  0Xff0S} SL0 Q00G 00 C0  $0;ff: 0R/  f00 S0v8 hP  ff0 P  P 0S -Q  DAq0/S90/Q f~f9 0R  ~fof0S S S Q[ 0K0000-Q DAq0/SV80/QR YfJf0S S0 Q00: 00CgP00S  rq 0 8 @ 8 0 0 000 Q00 0A0C0 AS R.Q0 Q00 0A0C0A QS00y0 Q00e 0A0C0 AS Rn0 Q00h 0A0C0A QS00_0 Q0000W QU 0A0C0A QS[p Q  000 C0 00P00<0 Q00005 Q30   Q Q[Q 0K000000 Q00t Q Q 000>Q0000 0 Q00 Q Q0-Q00  00      0 0 [ [ Q 00A S00Z0S\ 0J00 QZ 0S000L [ [`0 00`@ `` [:0 0 000 S Q-0 0 0rS< -0S0<wQ0 -Q4xQ@0 sQ!= SQ; -Q4rQ 0 -Q4wQ0 -Q4xQ sQ SQ; -Q4rQ0 -Q4wQ0 -QxQ tQ TQ< -Q 080080, Q Qk Q<  0 cP000f0 0B Q00 0B QR00cd0S'0tQ000000S Q 0 00C0  0  Q  Q   B00 0 00( C 0 000000@;0k[ KpdePY! 00!C0eP0 8 8 0 0 00<0S 00 C0 S0(0 000 00 C0 !\t'dPth@-e0@0P@ 0S 00@0/G-@`pPf>ghhiijfj7/ 07< 0<[[[\|ax0[[[[[ 03/0 [3/\ [Db>cl\p\SH-@- PM+0$ @& R > RG R, R R 6C0C=S 0 R t 0C?oR20S0Ѝ@ Ѝ/R R ,6C0C=S00 R 6C0CS00 Q $5C 0CS0 R 6C0CDS00 2=00 喒0Pk Ѝ@ Ѝ/>00.nR o>CNgk A{ { q>< 7? g>C :g 75 i> 0g =C *g j> #g j>C g g> g o> n>  n> m>00200:04S 0l<0050;00;0l:0}>00y840v;0s:S 20=i<Cem>a0S{>X;CTo>CPq>CL<Ho>Dn>@n>CC87 g>C7 i>;0'=C#j>j>Cg>;0;0<000 |<0 p<030;l 0CS`00 d<0`<0:0 .A,P`4Tq0$:0:0;S+ <00 T ;070;0;0;070;030;0<0;000000000 ! D0nP0 <E6 ;S 0CS 1010S10101010/G-`0 \r؀*MRp 0h 4-aPUh bPm@ 2@0 0203/ZdpP&0 p@PR ᬮ@PL 0PE0U 0 ኞ0QS1 0嘥P2G 0S,Q 0P3/0 p@P <Ѝ0 s@P 0AЍ0003/PU@Ѝ7@ 03/0 @<003/T 03/@\l )0@-@ 0 M Pf P00 Ѝ0 Q  000/O-PLU `p< 0 3/AT@T P0  _0 03/ Ѝ00S0S p@-P@^0S !P0 R0ıpp/!P0 0L 0CS 0/0- M 0  0 Ѝ/E6 /0S/G-PMP ;ZPPЍ  3ZPE6@  X;S 0S0Sw  0 [[TA@T> 0SPPP0R 0" P.0 iZ[P  [P E6  X;S 0S0 |[z[PЍ.0 HZ[P  [P E6  X;S 0S[P  E6  X;S 0S [P T  P୶@ [ [ ,d$C-`QMM_ P@{\P@1@#(p ! 0 Z@ PH ,4($srC>P1S< S0  S \3 0SE6 ( X;S 0S" X 0O]6{ 0 C{!P E6  X;S 0Sڔ9 Mߍ; \ $0 Y @P @ dP-\ \0  nY0  gYO--L R,MI 0-DPU= (D,4st8 xPh R' J0\ 1 00 p0 $0 @p@ P?z@@ ?(D,4sthP   0z0L0S h0U ,ЍA0DPU (D,4stxP ,ЍOm h/u@-L @RM 0h0D0S x0h S 06L R 0h S ЍD0Sx0 000Ѝ@:A-L0PS`pM  h@D@T x@h0T  00P   L R h T ЍD@Tx@  0 0ЍO-@G6吂,M PTpT l2003/`P 0WP 0 000P0T0r,Ѝ Z@Q ` 0Q R E  XQ Qڴ !00 02/PW  0P  S00 2/PA  P% PP0@0@p8\5UpG p@PSP 0 P0`03/ 03/v sZ,Ѝ [|,0 003/`w0LA-PMp0,1(A00 A0P' T` T@#P c ,1 X 0 P 00 0ލ>Z@ܩ 0003/ލlL\ 0hD\/xp@-M ` 0P  @P 00C 0E6  X;S 0S0 Ѝp@Ѝp`A-L@MT 0h@D@T, x@0p0PYP`1`#  0 WL0`S h0T 0 2PL0 S  h0T ލ ᓴᠴS h0T ᕴD-0P M D l!R Bo Ѝ 0Xp0D lD0l!W0D lD0l!  0Xp W-$M VP  VP$Ѝp@-@1T0M L `R0 hP  .D\' h xQP%  BR L R h U ЍpDP xP0ިX  2/0Ѝp@ P  00x-<<  M00 0( 0 0 ЍT$O--L0cMS  h00D0S x00+캐 [+# 0S,0 -R ,@+R0[,0YP]0. 8XP]YP [ 0*c:0*8{XP:XPc0"0XP\:X PW,0$00SR p@` &]0. WXP0]XP+?Y( X 0@P! Z,XP ,00S [XP ,0*+XP ,XP  R 1cߍ0 ,00,@[$XPI]0. 8 XP~]|XPy:wXPt0 !@XPm<@`P8p:XP@1@#p B 0 U0@L0S  h0R  @0L0SB h0T?;:0*8WP [3 XH̿(?0 S <8`P0WP@1@# p 0 U0@L0S  h0R @ xP  E6  X;S 0S {{80< ѱ  00@0<0 080=PL Q 0R0C 0 0h S[  E6  X;S 0SY< 80ЃD $8WP  E6  X;S 0S# ;0;[x0E&  X+R  Rd q00R 0h S4 o'01 /W_h80@-S@0 MPh8G0P Ѝ00a Ꮝ0 Ѝ0@-0M!@ X0 Q tt @hЍ| @R @ Q0 0 0 x&L>%l8SH 0@-p(P Mt8@P  E6  X;S 0Sl(\x8 0h(x80 Ѝ001]0Q 0S p(l00 Ѝ0 嶼0PQ m0/0{0Q _0괼O-dM0P 0$7@0L0pS  ^DX   ! !0tVP`xLFOWPFHWPL0S h0XF 0 PL0A S  h0XQ E6  X;S  RU Q0S RE&  X;S 0Sڴ=0  B 0h000101VP` S h0X 6S 0DD0\Pi}e 6&D3/teY[4 SPlD  RPZ VP}xVPw V\ F TSPm V 8 F JSPc 0S H6Z  0 ]`0StV70S P 0 SQ0dЍ0S #0 0I[ X0SZ 0dЍ0 㣥`P 0S:0 p0NP fP+0 0[U`0,000? b02bRPp 01(0@203/Pf 000$` 0 ` 0( ,0`$S*U0= 3/`PN  $  H\-RL  ,0 $( 0<48 S0 SگP 101Y Rd0 `PhG.PB0S)0S`[P2 0 K`D0P4Lā@-M@P QP0 \0P R 0Ѝ 0 0Ѝ-^R /A- PB M.^ 0 0@0p(3/0P` P B 0 0 A 0=\ Ѝ$0003/ دLO-lM[ M) P{` 420p!p24`;/P0S ![ #T  0 PlP ލ Ѝ!J|ʿ+ލ Ѝ*ލ Ѝލ Ѝ-@0@ 0  M2/0P 0<0 ЍĭLA-`PVP=h0@Pp =P =@03/03/T03/03/00lO-阡@P M^ Pp!TE Y`T* 0.S<@PM Ə SW  YP&Y T <P< V @< 1/03/T Ѝ  QP  0IP.\  P0 PRP00000 ЍجO-,MP200 SJS PyPbP p`@.YM000T=_SPC T"XS!0 dSP P3Y0 "R-00S 0;S000S# S PP PP W0p000 R;R 00 R;R+,ЍY $ 1 PC  ?"0 0P   ,Ѝ @P ; D0P03/03/0 -Hy @-KM P+ xRP Kߍ RP, RP R@P $ p@yR  $@$ 0R z0.S0'  0@P0 RP 0 P 0X (Q"dR10Ϡ R0unlimiteA-P@0@00M3/0003/P# R`P PPP 0QS@0#S RPmP.RЍ0ZO-@3M`Q0,@s 0RpP0p S@T ,0( @Pm ,L3003/t1SQ ;0400;`PH C@% Tz0PA<d h0 T v> X  \ 0 `   zOtx10 89/P' P)00V000$ ::0`80Q@  00 0<@000AE4@Ѝ+@Ѝ@Ѝp/o" t1So (0dQ:PQ !倱$p|q  @pTyP2 ; H! h0v d TX\ `PX& :@:! (   0 pzP (OQ0,P@? 0O@:d  @$p(?Q,P1 ÉP, 0`H4(pI H '0Q/p@-GTp P֫T@Tp@ݫ0 00@@0 0/000Q01p@-@P;S p"p@M-$ MR A6S S E6  X;S 0Sڄª Ѝۛ;S A6SE6  X;S 0S ਪ; 0;T0@- MP@P  NP  0 A@00CP S Ѝ00C-gMR`@p 0" PR' ' U: R R 2b> 7r Rʨ0&S &S  pR hR 0 9NPP 86003/P Y IPЍ G6 100NpPE0  NPE6G U  X;@0;; 5 003/; 0;*hE6P  X;S 0S(*A6S 5Q 0Qa 0CQa;0CS];6ZY/O ᷩKPЍU c>0Sa +@^ P\40ph,R E6  X;S 0S00P0 3/0 [3/[0 oP X07E6 0+0 MP 0*M0PT LP;SyU ṆQG0 #Sf #Sc 0 <PU" < 0   Ĩ/P 0  MPP 0 3/LPA P L p<R E6  X;S 0S h0l,ɨ03/03/03/ꔟ.(/Dx@-M@ 0Ѝ@}- M 0傓 ЍA-@PT8pD(0 D(T8{`0MUW1@ B6x 00| Q F᫋4P0R  0 0@00]D6 200#QP /x:|ʒ 0 ;SQ/LL0 QQ/ Q 01 /;S/C- 0$MS@d< S SP. !O !>Ob>0 P000@00 $Ѝ000$Ѝ0Q6E6  X;S 0S 0 Dp@`$ЍCp 先P  0P0  N 0b. 0P\  @ PP 0@000\@-0M@Pp`{QJ`Ppԛ}V00#03 00fS: 0E&  X+R  Rڜ 0垧 0 0帘 0!2! L8S. <8S * E6W 0/S X;S 0SR< 10 `xᰊ 0&Ѝዛ` 0pPp0p1S1S  S X;S 0SR \00XIP1  0  0$  0갚<8f\H@-@IP0 R0@000@[괍A-@Pp`@T PLV ! 1}JP V@@8V 1 #nJP V@@@긘00H610 00 >6 0CS0 00/0t 0 0/`00/0T 0 0/@00/800;0;/$00/00/?p@-P1` B6@A  JP 0:0CSp@TpDO-@% M\PD`2 \9 \i \\Vz;S^ X RP 00 00@ST5S  BPH5| 003/TJP|  4 0 VD 00 00Ѝ2%0P0@S 40U E&  X+R  R Vx Q H$ @4 0 0 0 0@\VT5S 00 0 @0#0P0@Sz 300P0@SP 301 #0 MP+ Q R XhJ0Pp K0 J3 0P 0S 2/V  KJ03/0 S0 3/ 00 00@St 20{20Q0 " T5S7 x20t  0P 0A  c귎+`` VT5S( 20VT5S, 10! W! R 00 0: 00 0j 00 0E6 I X+R 104 00 0E6 = X+R. h10( 00 0E6 1 X+R% <104! b,] 02/ 0VT5S 00k3/02/ 00000w00tE6  X+R 0000h܏ؖ`aЕ40jDi`iL_08P,<\h^Xt4]0@-x M KP:KP ;KP K*JK2Ѝ0Ѝ0脑3A-0`TŐ0\dC@  c^M:p^>@ P_ $S9 + SH KSD80 ;SS 2 003/Px D80D8CP  r ЍKSD6  0~0P<0,QR " KS000 ! @gP@0 S=! @UP.;0;X0QK  KS000 ! @<P;0;{1003/0 003/PL8; Q  KS000E6  X;S 0SdLL001 0 Q ؍p@-`1P MR@$3 +RZ 8(R <P<(H(R LPL(*T80T8 P 0 0 . .D80S* T80S& 000Ѝp8(R0H(R LPL(10 S 0!-00   P  D80D8D80SVV 000ЍpTPD(T8 0D(T8<P H(RG-M 0Q0n!MN` `S@ ,,,sP pPiPHP%,HJPn 00J0Sf P 0 a 000 0Q0 !P;0;0@00 @0@R00U0 E6  X;S 0S;0;000 0R00U0 E6  X;S 0Sڀ;0;0 U E6  X;S 0S,Ѝ LP r] Pr0 0000 0y P U E6  X;S 0Sڀར;0;U E6  X;S 0S8ઢ;0;:V\Dtp@-M@P` FPЍpK*@ @aHP2I@(0T:  0S ( EP@D O-Q Pp B?pP>W<  DpP 0 P 9Up?S0Ե0ó0ĵ P- P 0S(D90 R+@+DZP# :0 03/Up*?S'ᶓ0KSQ ?S 0 P :S  KRf[ 0S P{ 008 0,P 0|U 0X(P00 PrPy PPQ ᖑp0 8PP4S  mPP6 S ;  00 [U0TPIP0  0QP O0S| H ECP0' ,0QCP> P 5PbD63_ ;@0;'CPT "POCPG5SF 0SC tQ@  CP:;9 Q5|Q1Q-Q) PP 005 0|0 S0030 E6  X;S 0Sژ00001 0ShU PP 03P0BP0 03/0;:S  P*BP0x 03/0 x;P$R BPq 0 R00S01L0s.P013  kP 2l tBP[)0 0pPБpPˑpP[[ ; [[p ?P0 3/LpA x{>{pP# BC @A]@DPpSXpPT Hᇑp>WG1p 0 H<0SPrpH P2ّ0p 3/1Sx |ʔp 0 0*: 0  R00qA0S; 0zP6S[A10t P 0X0T1 0?PPp 04P p0[P x$$84Ѐdw"<~~H~}\&}(&H|,<{{Xz}}}k@y{Xz,zyy&9TyxxXxDxwwTx@PPS|40H;W0 STpO* @Pu 0.y{P5P P00 5 50@PP& @K p(@P`!*i(@ 0p4`*0S %Y 0 v?0 W0pm?0 ?PpL )fpD$ ?0Pp;\YP0ܚ1Z 0S ?PU  ?P0St Su Sz & ?P =PPa 0%S 0>Pa0  >0PZ$0lAP 0 >0PL z>PF0P T?P?=\QPO?P0P03/UDAP F6   ?0P P 0SBA0@s0S$(23;4@i a 6?PP Pd( l( _=( K Q *<R 0,00K \ K:8 @-8\/0Rk]p@-`@P0 e 0d BcR$  Pp P0d0CcS000p8pO-` PDMl@ R R/ R 0 S (001L0S 00 $$P{?PN $?PI0T/$(?PB0v@80<@P: (00r $@P0Q S S  Q  RK :0@P0T .A0C 6S>00 00%> 0a>0P DЍ000 V%, <P 0 $00#$00( =@$(gP%?(0P0C/004  P0 ;+0p1L00 ᣘ0 d0CcS 0 ^ P0P800P@00 0n<P0 0  1R 2BQY Q Q0 Br 00Aq P0@p \ 0L| ^d  0 0 S S004Ԙn{=0=P0= 0Rp0R R0000S; &sr 1  0+St +S 0S pP`P`0KS 01 d މP0t 000p000S0ԕ00ĕ0S0p 1 0000E6  X;S 0Sڤx*|:w tQqnSRE6  X;S 0S0|{0000000P[ 0'&U Fq`l0l 0000<DЍ <5P0 00p0S T)#!R D0 +;| 0Cs0Sx:%0O Q dBcQ0R010 R <6S<0<000 TU  0`PcQQ dQ `  eQ0 `cRdRP eR R Rj R` 000;SR0 Q00{ 000ࢗ0pX6Si kVP` H .;PY 0 S 0 S00X!Tpc?!pAXA0&V0C?o20S8  ;P1  P  6003/0p#0p0;S 0SV<V :P 0 000pV5 0:P5 RV :P D Pl  00p<6SC6 V?0K?CcSV, :P 0S 0PH RD5003/0p0pP6S V00+2iT6S "kVP x t:P TT P E6  X;S 0S$0p0 0p- V;0 V(0 L:P 0 S B:0l Vj 8:Pc  00Bs0R S(0 00Bs0R S*R0KS*=CJ 1 01DaI}0P B R E&  X+R  Rڴ0化0 0  .R$ 0BQ  Q Q& Br 0 0 Br P 0@p \ 0L|0 S0d0 000p/YE6  X;S 0SNy 0b1 b0 Sf1L0b;S_ E6  X;S 0S<,dyD, `<6S p:SP>;000E6  X;S 0Sژ9yD]hmF m`TaLlg vPK8 7P  y0P0D63 ]w0@000p 02/0;0pqp @ĔD$0f Sf\ &q&'0 SJ 10":P0x |*RP000!  0V7PV0z0 K0 S7 00D7PV 007 0)P@ vE6 ^ X;S 0SX,൓0pSaP00C6H 0;0pES E6  X;S 0Sڨc!`!S X;S 0SvtP` 0A6S 9003/P ;0;0p0p9 0P{ vE6  X;S 0SڼL0pv0pZP 0 0 E6  X;S 0S<*bv^; 0;p:003/ftS2P 00SE6  X;S 0S4SW VT˒?`@-@M` 00@ 0p @P00SЍ0 ЍO-$M$Ѝ0R`0k X3{^00{~0@P 0p" <PE 7p7 0K@ 00pL70S K@00W;[= 0N 8PJ @ [7pP'  Rv7p7!L  P 1 #5P pu0 SC1@@;m 000$Ѝ00S{^{~P600Sz0+ 6tp p7Pk0 000S-7@671L0 <P" 0RL 7P 7@7 0'P 1x #~5P000 ?u0 S1@;00ȑSQPhP@- M`0@pP P0 Ѝ 0UQ V Ѝ@R0-A 10 Br ^ \0 0+ 00/+ 0X p@-@P pH08P03/0<3/0@3/0p@/P<@-P0`00 Mp0H 3/@P)  Db7U  ʪP8 $0S ªP< ,0S ẪP@ &Ԡ&Р@ Ѝ@@ Ѝ;LO-s3p0`0$MHP3/@PP~  D 708 6P Pn80H ?oR20S^P PPPP5 05PP]0S<0G 0 5PP00O 5P P00F R  5P P<Q 5PP6 R t5PP-`5PP'5PP" R ,5PP20P55/<P1H003/P8P@@$ЍP1`03/03/03/0 3/K5U PP>50 v5P60 o5P/ Q: R@P9 g5P0 R r5P'00p{57/@03/0 3/5&&ݟ@$ЍP03/0 3/4@PR@P:Lܹ|LBO-P804MSp 0D`<@T ן,60 `PPXP 60 ?oT20S 6t 0P@@T 6@ 0P| 30@ 0峟PᲟP# 肟00P:  X ПP[ᖟ@P4ЍT6P 6P P @(B(@ P P00,P0S  R R00,R0S  K6P  6PM0,SS "S 0,SSP@*(5P @`4Ѝ,D`@5P8  PP( ?6T) E6 & X;S 0S ڴ 0 e @P@ 0@ 5cfcP H000<00IlI\I0I@%H HFTFXF<` =T p@-@P pD00P03/⚞$☞@P 0p@/T2@-P0P0 Mp`D0 3/@P  `R l0003/P &g$&c@ Ѝ@@ Ѝ1LO-PM $Mp  K5PUK  @@R`[00CT?*q P  JRZJ  2 Z8 | 1P`0X 040  00` @0/S  Z* ` t40 TP0 @ 1ڍ$Ѝ0*S 0 ` ` 0 @ ` 0 1P@ 80 0U2P  0@@-( @e2@@20P/ - M0 20$  $ ЍO- M4`$  @P00S P P2  4P_ @ P [ Ѝ3P 2P`23 R0 B \K \  00  R:QP H  P R $  $ 2$  ЍDP ЍX000 P Q0 02/P R Q P 00 QP B0@-80PS@MD $ <P @\ |o2P Ѝ0ᇞP <Ѝ0@J2, $00?\?0mد//A-`:pS4:PO4U@PE T@D U 1 !0PE83TP@D23@G-M@p?2P<2`9262 # U$ VЍ2P2m3P0  X S  2@ 2ЍGY3ЍG-P4! M 0 Ᵽ0P  Ѝ0S( p0C`@@p 9R'/R(-0BS%+R 10SV  _R  zR`R10S X 0 2/ 0 ЍA0BS 10~R) ==O-PMM 2P 0@ ` pH0Z@0&S Y P$1 `1Pq`V Z0@&S Z@Y P 1 E1PV`Vq V 2~pP0` Pp  S0P.0[ Y U1P F1=@3pP`@:  00G 40E0P A W0 00P ` P@p0p0T  V @p@0TPۍЍ1p 00 0P d @`p 1 0 P/000000  @P0 0P pY   0P00@0TP 0 @P00 0.괫988p@-@`Q M $1 !SA0PP Ѝp1 A0 ЍpO-P S-00  %@Pz31 0 03 @q3T00E6  X;S 0SڬKE6  X;S 0Sl: @E6  X;S 0S4+00(0O-0#|,p@-@QP` E6 000Q P$ 00S Q0 S00Pp0p@0/X;S 0S00S  pī0O-Q`@Pp M E6  X;S 0S00S" 밒尲専 0 03/Pp0S 0SWP+ Td E6 O X;S  Re(  %PaE6  X;S 0S00S[7P< 0 T E6  X;S 0SڀuE6  X;S 0S00S@! }7P 0%P  %P   Ѝ %P  %P 0%P0  |%P x  F00/ Ѝ 000 ЍPXP@d ļP - R R P 8/00   0- M Pl T R :0%P0 ЍPT`!T R  ЍO-pTM@H`D ?0@ ?0̄S@ '0D#PP $0 PH0 00@P HP 0H0P4003/H00TЍ,,40  H 0< D {@PY Q H`P# 0   P Y B6@ Y H 0 #S t#0 $ h#,P P( 4@20LL0 %L0S' ($@pG;0S0W0Sb;S9 WSB 0G?o 20eW00ShW= WF 0 @PYM `:%PpL;$pP 0LL0$L0@T pGH@Pdf W b!P;S X!P $Q!P P (F!Px >!P;S,P4@01@ /!P$ '!PR%RI 0SF HPA @ p0p P8 H P1 0   P HٍP @,P0Dt PLel\s` Xpp@-P0P0`0M3/ P@ T  P@P  80003/Ѝp P LP@0S//0 /00S3 0 ??0s0S$ @ S S               ///@o//0 S /O-\M`p#"PP@TP P 0S 0S U P@T@!\Ѝ#@PPPT#P  V P %0 S Y0Z SSP@0  X 0 A P@jY $   4 PPhkp@-@P0 0`03/0P3/0 P3/0 P3/0P3/0P3/0P3/0 P3/0$ P3/$PPp@-M @0@00Ѝ@/ 0A0C0 @ RS00 @P #P!0@?o00$@p3020/_P~P00/@ -A-@`(, t .0#1Ⴠ10A p0 P." ?0 0? 1M@#A0 p l l(0 l P ЍAЍ/,0l 0  0JЍAЍ/ONNNNH0@-@ MP  P R Ѝ01  KPX  P000 #J00S0P0S`0@-@PP M0P0  J0?o20 Ѝ0p@-P$@Pp p@Kx4@-@P  @ JH@- 0S@M Q \1  *P 00Ѝ\  0S" Q \  \ d  L D < 4 ,ztlffff<0@-@PU M000C S 0S  Ѝ000C \@UmP  0 S @Eo Ѝ0 S@@-0Q@PPM& p `1V } fW P' 0S ``0S "S\S P P Ѝ|000Ѝ@/W ЍP vP0S, lP 4̹ata0p@-0` 0PS@M $\  N0S  Ѝp P 0S0 `   05 H  1/ 0,0,003/0bctxcA-0 0 Pp` 2/@P+ 0 !0 0H00 0L00X0gtl%It0t 0P (03/ P @0@0ݏPL  t8p@-@`@J@Pl80PP|03/0|`3/0`p@/@-@M0P) 000D R$0 S S'0 \ \0  @ 0| S S 0CSP BR00+Ѝ0( + B`0@-T@ MPP +0  Ѝ0@H Ѝ0L0@-PxM@  +Q P0 <  IЍ0  Ѝ0@AЍ0A-`MpPgl@LPT `C0S  0P 0 Q/ U0*S R ЍU +R 0S S y0 0+S0 S R0`"0C S0 PEPEUt ORt Un Ph0 0! P *0 0! P! P RQ Px P d! PL P8 P$ P P P P {P uPc +0 0r0 0n0KS0 0gl  rPL R X<8phXH8( dA-`M@PpUp@0 T  l  '`X0p03/03/V00Ѝ$0T 0  ([[p@-0@M 00ЍpPXrP ""0 XrP0S 0 0 ;S  Xt00A-@,PpW+ P`TB6 0S ;R0 S#1S 000 PF0@0S0P0S[E RSAT ,0, 0 "G@P 0 dYO-DMP40 0@ᕍ0PT(0" 0SF 0SS(`  $0`FP${L [ 00C S0 [00DЍ0n*[ [ DЍ[ DЍ+[> UU@00[000M{*[D , {+{P , 1,0sPe Lw00DЍ0.*[0 [P Q P 2003/P| 0S2  00XrP00S ST 0S8@0S[ :6S Dv@|0*[< :6S KP[ :6Sv[ [0!00 PT00GP5L0U00 E6  X;S 0SDv R (1 B001r 001R00 1"  R Br R  TR  R RX X  X X h RvCPLvH|4@lܿP` 00`0iJ P&Pp00$01 00KP00S0S,X" P0S0 T00N 0P0  0A QX0 ]R0 0 P 1003/ 0 D0h0SB ! Pc 00 },PU E6  X;S 0S#Pu#S@X#QP 'ᤣ00ꄀ60"00㴆Ḇ0 yP00 ' 1mquz P    PH0 \oP 0 Q& P   P  00 ;S  ,$u<uX9 8SER000SM$ P00^0D000X01S0c0 0+gPU0 E&  X+R  R 0 L R 4    0t0@S*A@/0@0*p@-PM@֊0P `0P0  IC0P/o" Q RЍp0Ѝp0厢0O-p弽@PP@l W0张Zg 0aȁS` =S @ 0S=SS@ 0S;S  P$ 060;S 0SP0>  0(1(008 }0@P0-  B0?o20  P 6S0 S000 KXbn0;SP 6S \ S 006S0 , S00008DO-plM`0pZ@PP0E ܚ PY+ :0 0 A0 Ŋ0P0;Sm `0=SS 0S=SS 0$ H姊0P`P`80( H喊0Pf $P 0S $P 0S $P 0S $P 0S $P Q80( S 0C/P(  8( `$ 2/0(3/0;S `0S 0S 0SP   A0Px 0 0S 7003/0$0$0S  0SQ 0P 0 ZQ 0 JQx elJP[u 00000P  |Q3 P P^ Q[ P;O 0So 1SO> f0P:h0X/SH  8 (R  B/P0(nP6$@03/0(3/0lЍ8 (R  B/P0( W8 (R  B/P0(L8 (R  B/P0(A0;S Q1Sv 0S 1r0 1 {0  00P@ ࣞP I0Pg0 S0P0> (d H@6S 8 yP!$0  $8  0S @& P aP  \P WP 3003/0f0 $ 2/0lЍ 0S Y  0SPePPy 0 @ /o" HF0S8 R5 R2 0.;w1St 0Sc P 2|P03/0|P3/PPz ?PP "0   2/0S00 ;1S*0Sq@0  k  P! >  !0   ! 2/0S 00 E0 rL1003/Pg 0S0S0S]0q  P 7q0J0PqY 0S  /060S0S+  a0P 00) y,pP4B| 0 000/ \ 0 0 /Q R 0 0  000 0S 0 0 0 0/\ Q      0P R P P  Q A     /Q/0P/0S/- M000S  Ѝ/ Ѝp@-@P`p 0SpP PU 0S 3/ 0Sp/ // //O-p0\M0 00000 00T00 X0.0 0!@,\@  P>,`P ! ,#*d  " $  h0,0l0(06!>0#0&p,"  Πt 0,< ! `*#&x`  " @ $@ |@0, P>!(P<0#P0,.8 " ̠ 4P,0PP : !4&#.  " 8<0 T,@0 [Zₘ00y S`;P^9  `00H`S(`ɠ PP SP[ ( pC. .@ @+  P @4ˀ ; @@ ,@);> 4P2 @ @0N;M@@ 2

` `$P"Έ0; > 00. -=8 P䋈 @  掃n`;#Z₈y♀@+9# 0)"." D艠(( >;#:#+0 *"("芠 ((8PH`>#;#.0(+"*"苠 L`((:8#>#0P($P."+"莠 ((;@:#8#*0("."舠  @((>@;#:# 08+0:@ 0S 0 00 000\ЍnyZ@-`M@``ap >?R ` ?Prp80ES07 emPQPPuQuR% PSuTuUuV% |@ WPut0u0p0u0l0% 0h Pud0u0`0u0\0% 0XPuT0u0P0u 0L0% 0HP uD0u 0@0u 0<0% 0800Ѝ?  p? e@ 8 #EgܺvT2[@-P@-dMp`PP  EdЍA-`0`pP03/@P 0 3/P 0P3/PD0P03/03/@0003/Ԯ0@-03/p@-@08P03/(0PP03/03/p/Q ` d@P!P/L`  P` / h  Q//O-d `Q\Pi@\`q#`d B AQ *hi` jČL?L?,?  ā Ȍ̌\`d ^@\9*HQRp@ B\`RT9 [ d` Q AQ i h$(B?B`dQ` B#?   `  ` \ @ \ [ RT[ @ R@@$ d==0@DP0/Pp@- @ 2PP B0P1#0! R@ 97 P 00$ h$ˌ<`L.aLH0 P@P@4#0 #10p諪k(k(0 S QS:\0 0 R / S*!`/ @o///X@0D 0/\ \ S@D\%//@D 0PT 0@-$0$ 00@03/000@- @H @@RM\0`0d0 R 0 0  D  @  D@ y D@ r . `V 10 D@ dpUp PLUPH-P0.@Q2 `@P;Pp`Fu uf,H O-PRM. p@d0LH0`S  X0S d0P `P``Q!3P X0 P 0 5/P pYP `XЍ0\`dH0LPB`Y! P0 0P0T0 p0 PET0U LH0Y, t @ P , 0:S) 0 S 0 R 0LH0Y0, 0(00LH000LH0y  L0S_@Q BR !d20 a  P00P0T00RT0pPEH0LOVy`dPQ PUh`PPdPpa h0,eLPJpWPH`Hh  dP` U hP @/rpAdPK+YP `2 Y8y8 p PEZC Y!HhP0@/s, 0Y P0SH LP Xp d0`PdPp$P  $Py PP `Dܝ`O-RM0M200 0 p  0 S pZ&0` 0pp 0@U0Y  `0 S0S S0 ڍЍgP8 0~fڍЍvfL\O-P`pǟL0  pMMc@G0S  R$0RnR0`,P, Vj0@0 00 00Ap @(W E6  X;S 0S ڔ600Sڄ0 g(@T3 T# TP f*@0P E6  X;S 0S600S 0X \!0@MߍP E6  X;S 0Sژ500S0X!0(@\!0Mߍ,R`P`, W E6  X;S 0S 500S f,0@ p`P$000,,00p  PP@`( p ZWrP P|e* X1\pL0*@0pL0( tmT 0$ 0 Q 0$ SL0 00L0X1\!@L000W{ @E6 x X;S 0Srڜ300Sm\1 0@0X10|0b`a`Tf\   (0@P(@  $0@P   (0J@P L0(@0L0@Tp 0Tv\x $0R 0X \!0L00L0+e@0X!0\!0L0(@0L0T (0 f%< fts e X1\pL0p0L0( @\X1\!@00L00L0rE6 0 X;S 0Sh100S?0X!0\!0哕@ZX!0\!0劕@QX1\1偕@T+ X1\@L0 0L0pd X1\ L0 0L0( e0X!0\!0N@Ld$DḼ,$ȪتLP/p@-PPp0S  !{{ 0    $ \ ` d  H h @L0T` 00i03/@T0p@/ P 0S { {h  0    $ \ ` d  H  p@-P0P0`P03/@P {0{ -0 T $B{P{ @Dp,0003/@p .@-6 h!@-x @P M h0003/0P .0"0 hR@000Ѝ0Ѝ@- @P M p0080 3/080Q  @0003/P8 Ѝ+Ѝꈅ@- @P M p0040 3/040Q  @0003/P4 Ѝ+Ѝ0@-@P+ M7 0PS  3/  0 R @0000$0\0`0d00H0h u |P  0X 0  0H H0 0!@PD Ѝ0 b  Pl@-1@P0+PlMW p0PS 3/ 0   U @0000$0\0`0d00H0h!:   PP400`03/P. 0 $0: S000#$ 0000 0003/P`P P 5/P`0p03/`U 0P3/lЍPlЍ0D@- @P M p0000 3/000Q  @0003/P0 Ѝ+ЍꀁA-`P 0QpX0 +pD@P@@@ PX@ pQ+pr0P% QR,   /,P -M 0 0QR ,   Ѝ +/0P1 -  ARM {02/{0 R$\`dH    0h!  {  $ Ѝ+/A-@PD 0S 0SU 0S` 3/ 0   V @0000$0\0`0d00H0h!8 0SQ0S 0SQ @0S PU pGPPpUW A+0@0D0H0X0@0 40000 `0 000 A-1@ 0PMRo  @ 60S,P !cP  t0PTX00X0s0PB 00Ѝ0UЍp0P 4 0 0` R P R P   0`/oV" RmP0 ! 00 0$0890P40P00+0*,A-p`PM 0P;p Ѝ-0@-x0M 0@ PP :b0P 0Ѝ0@ Ѝ/$0003/Ѝ0@ Ѝ/{G-`P ,l0lP0@Pdp Xd0 T:DP 1hllO-@($MpZ0H (0R L000`%V 0S-  ,PP9 x5P0p(h pPaP ,PN 0H 0CR?o( L U20S$Ѝd` PU p  ,P V W( 40pX\ P8, Q H 0P 4 R  H 0P0 <<$4 0(X0S: R (,P $ЍQ40S30 0(   0030 02/0 03/XVr 40S <H V Q R0k Si #  ,7PP00 S`@m u`P b`@T\ H0  PT@TOpV4QZ H tPZ042@03/03/W+S S8 40`S4 P ,`P`pP;4`P@ 0S  (P H0S 40SS`l!l  d!0 (Z80SuV 4 FPl   H P 00  (0:v`P0 Spp04`V S ``S``y8LH,pؚp,@\\f Lxx 0dd0@-0@ MP 0RP Ѝ00PP p 0!S Ѝ0ERA Ѝ0@oO-0,Mx00E`d` p0 SPBU50PU000  9/P ,Ѝ0p 1 0QX ~   0d0$ p  ` 0k T 0@P G* 0 KS` BNN ^\ B0N0 0@0@D000W0\0S 0S B0S 0PBS0 UPBʟ0u00/  9/PPE 0 &    ~J  6$000t 9/P 0@B0T0ʰ0@T00  9/P q0 Q~` 00> pHH 00# !!0C @TP!P@" [P0 O GP*KN^0 0 B\ B Nr2  00$B0@A0 B 00ZQ  0PSUPE0u00 09/PPE 00-9/P 0 S  09/P 0   X9/P  0S10 @ T0[00::9/P@ t9/P0000PBS0 UPB0000+9/P @ T00UPE0u00  9/PPE 0S 0@ 00PBS=0 (UPB%0PB0~H  00$ 0$Q00^ 09S@ BJ0Sf00050K  9/P_ ax9/Pp \ 0PS 00X00@pP~0000e 100$0SZ 00$I00v@[S*a@r0@ 0^+0 p BN0 0YRPB[ 0S001W' ^#00M BD@ 0 00W p200 00 @ 0^0 p BN0( p^ pѼ0 p BN0 00 p B0W @ p0 @ B 0#! \h4 0 000/0@-MP 0 P $ P 00 0@0Ѝ0@-@0M 0P dP000Ѝ@-p R030# 5255 5 2 5/ -- M0 0 ЍЍ/O-WMMP0吀HS]N<|v l @0 DPH4LS %Sx0 %S00@0C$0s 0S 8H0P800x% 0`pP(0H4(08Hx0 0CZS0 x%0EC43\ \x% !0(P*(px%Z @P0*Sk -S !0(H8HpP(`Y9 S x%\ P P 0YS p8H.pP WݍЍ P P P   P P SP 0SʁƠ01YɃx0S g` p RDPHLW`0!H%RR. R  0S`Xx8H`P 0S 0800x% 0N0 80J x%0!(H8HP(``fxW   W[1H5SS1WZW0 01БHSHC VF1H5SS1iVgZV0 01БHSHC80q 0 0Q00PQ001HSΌYxHC@0 ˌZ Pq$` 00p00000`000  / 0SY0S005@p0 0^$` 0V`  "؁XXlh` "ؑɟ" ["    PP؀<."l<0Lxtpe 00 $0 08 LP0 0S0P| WݍЍ<."<0Lxtpe0% h%V.Dd .2[-0<0g5D<0'C&C+00 00#000X0Y{3[Y\QQ23S 0k$0`xtpe00< 0<0B 08 BAP 23S  y Y H'Y "(0:/P| (0|%5 [ ( `K0PP`@C:/P|zT| P[@  0P X |` :/Pd V|(0SU ":/P|W |%L2@#|5q 0?0C `F`HP :/P|:X|` 0 )1!X0  [00Y [!X1`Y00;QXQYH{[Q?c0E{Ak{{0C S C ? 0 [ [ l00"  e0E000$`0<0[( CHTP |P| :/P WݍЍ W 0f0  g0G0 $@bE F \ `|H [H :/PK{(\:/PP|V[ `Y|  :/P y00Y0SW HY( H10(000xPP؀$@ !(! (P[Q+ʀ 0` XX H(Ř`| :/PJHx|[0 P [( @D H20@  \f@ \^X[@ \S AZP ZMPJ WG@ \?=;9 R$^ X0 (0Ņ`30X H(Ŕ[([Y  X R*{[0(0(0H2|0 0(0(>d00(09{[QQ00[JWX0 (0DQ$@Ep T @-@@M 0S  S@B@@Ѝ4@-0 <M PЍ Ѝx0@-@$M|0  @ 0`PSP ]P D0D003/$Ѝ0$Ѝ0A$Ѝ0z Wh-- M ЍЍ/--8M0  0| 0 Ѝ Ѝ/--8 M00 0$ f ЍЍ/ V(--$M0 0VЍ Ѝ/-0 $ MH 0 Ѝ 0 8PUp0 0L0000/U- M 0B Ѝp@-@AMPmP `P:Aލp D0A&P PTQxA-p M`mPP@ 00 0@P  Ѝ 0 V0S `FP (@ Ѝ A@ Ѝ ЍLx@-JP Mp`MP  0 nP0S* Ѝ(!W ЍW$wv-0 M+m0P 00 Ѝvp@-@ P0P0p@0/0Rp@-0 0 `P@ M2/ P 00P803/ P  @0@ 0lPЍpЍpRLXvuO-pP T @0P03/03/E6 / X;S 0SM(E6  X;S 0SڬtR0040B@ehRpcRE6(HXllkll4kdjjhTh\ghfgxfg8g4ddd/p@-@Pl0l 0`03/m1 0m1PP2/m1 @0m1PP2/m1P0Pm1p> 0$!S /@-@E0 M XQ Q  R T @  !R Ѝ@/Ѝ0ER LR0T @D$0O0D<J0D$ P0,  Ѝ@/D0>9c-0 M0 0. Ѝ2S/4C-n M`p@PT @ P0P88  ^(@ 0i Ѝ0@- @ PM F6 0 00F&P Ѝ0    P   Ѝ0@-P0 M`00 i0S {p0c0 _E6@C !R@ !R=  X+R  R!  R#3`12p0"!;%!`Q3  ,ЍO-122f1p X  0 G,Ѝ 0 %P })PE6  X;S 0Sڔ000Sڐ"PE6`.P " GE  XQ Q,[P:4`_^\^@^O-RM`2P 0p03/@P `2x0$p ሄ0< H0044"02  000 Td0d10P1m1 0m1P@ ۀP;  րP6 рP1  UP,Pd( ;D@0;d td  ఄ◄ B P000d*@ aP W1aP,Ѝ0ఄ0$ 嫔ៜ%* d}Dd0S dD 兇ᲀ ᰀᮀ嬀 :D0003/@Ѝ0\1`16L d- MG0a  9 ЍPm/ 0R -Mn 0厂P 0  Ѝ  /p@-@P@n⌂1SD011Sp@0Spp@/C-@H70$MP`9QA 7 0R0 0P }Pp E6 ( X;S 0S"ڼ600SڋC0E&S  S S5R X;Si 0S0Sf0SOW 0S $ЍDP 0sPPtAPCP"P E6  X;S 0SڌN1, R 2/P P L N$Ѝ1 0Sc 3/P1$0S R h%pYpP*}Poc0Pk  09PC0 9P\ c#PW E6  X;S 0S400SDPQ qB 0?1(0SQ 0&p0 00K9P r 00@9&#P RC X;S 0S=0S50  ß   b` "    `|NE6  X;S 0S 00SPH.PY 0SV60!0008.R X;Sd 0S0S0 00\ [ !  000/0pp2b!2qW=9G =C pa@P c@P ]0V'(0 01f1΃#(,p0   hAPI 0  8S#8SN @ᔈxd0 Md 0SE6  X;S 0S<1 00S74Ѝ0 P0 @d P E6  X;S 0SڼK @P 0$P @ P$K 0@ `p$ `L '@BNMA-qa@0MQ1  0 SЍ o)f 0(Q1p `   i(P0  RPX0Pj  0DP q 0|QЍ 0(. 0@-@ M G ( Ѝ0A-`0pPS@P U@P O0U 0SE6 X;S 0S0000SUK AgKx"PKD81Q0B 0@-@8 MS8S Ѝ00  ^0c P0P E  XQ Qڨ0J000 R E&  X+R  RP   R (( Ѝ0/ 0K0!JDJ 0R -Mn 0-~}P0   Ѝ  0P 0 S /j P/D Rm101m1/P/DPm /d/A-@M%P0P003/PP bP` ` 0 `yPa00Ѝh0P \ R+ -A MQ& / Ѝ HJ{0 < $ 0~P0 0d0S0@ /{{ 0p@-M00D0(aS`= 0Đ@\/ mP 0P \00 03/D0  0Ĕ 0 2/00$D0P  m mD0) 0ЍpTIDIQ4I(IFFFFD m1 0m1/0p@-M00D0(aS`= 4Đ@\/ mP@ 0P \00 03/D0  4Ĕ 0 2/04$D0P  m@mD0* 0ЍpTLIDGIQ4BI(=IHEEEED m1@0m1/p@-`D0QSMP0 mð(@P \*0 003/D0  01/0 D0Q` mmD000ЍpHHQ8H( HECED m10m1/0@- 0 P Q M# @ }P0  \ dP E6  X;S 0SL000S} Ѝ0@ ,I A- PU  M@`p.)QЍUq. r. 0R1 R9 hl rq  7{{{0 {FP 0 S 8Ѝ9*00{0h {F 0@ F 0 F>=$=(=C-2@P0M ` 1R Ѝm10 Pp{P'0 {P P 0t!Sd0P 0S  D{ 0 ; f~ dO;d0S E&  X+R  R   RڴFd0 D \{dC~00SxG6\$bw0`w<^wH\wz(  2/ d<A-04M0`0Pv $PrQ (-?!PD RPgm!@PbpHP 08 0H 0zp0S 0z 0"\3B QG AR*? NR*??R@9*E&  X+R  R "  R 0EF0$0vP000vP0<vP 0HvP/zP0 PPЍ 0wzP I!0RD000$v0      D0P q 0v00O0PP0.^.{d_.^{{_{F&F  F&E&  X+R  R   R 0 0z0 EPЍ0D0Hz00 P0zP=zP 0m!$ m!v00~v0<{v0Hxv0@8 p:t8<3P0 G- p$3MRQ 8 =?1RD0PS P0s @`yTm1  0BS00P0SP R  $5HnvP00C0Ɂ0 00S n 0gxwP  0!00 B6 H0Sc '7sr H$T0P 0P 0 V@y$v0v<vH v0 D00!Z"E6  X;S 0S000S 00:y 0DЍЍ/5P  ' k'p Q   \  $5mp@-MP@`0P Ѝp0oP &0  Ѝp0/y00O-@P0S0a [400 02/0 0 0찄0  0V0 0y D`Vv  6/0P 0| `0 % ( 1  0$00(0 %0SA 0 $ 0 CR3S`S]0 9 0C0`0 ,  02#0h#0(SA P1@P D$0S 0` /V`P 1T0\V `'0S@ 01- C  0P S:-> *0&0*0(0 0 CRaS 0(0$0Sqp [\ P 1T00 P1`00a$100kP00S 000@ 10 00 kP` &  00P 7SS00` 0S D`V/  6/0P `0D0003/( 4,8+X#&(\+4H+ 0(` CR9E6  X;S 0S\000S{t >u\ [ (`oob`f0(( @<@80T`P D&E6 W X;S 0SQ100SL( ]>F0$01 01= K9!M(%10S0$00/0010u[  10 n 0`0 00&0`q0S10 0 02/V 0谄0 D`V  6/P 0   0& 0P 0T 0`0 0k /`0;/ `8 0S}G-0@Mb 0T` 2 R `Ѝm` 00$0nP`# dP E6 `^ P| d0S F00Q   P` $nPd0F&0 RT 1  S m10m1 D Vp0 n 0S 0S  0 U 0SX 0s1#0V`0 P E6  X;S 0S=<bn$EnDP q 0:n [d  $Gn0DnX;S 0So,000Sj (=e O-PM`0Mn,0P \ 200006E6  X;S 0S100Sh0pm10m140 0l07/m1p0m1D08`0D0 $ЍQL<^@PQ\80`VQ\`8Qm1 0m1Q\`8V S 0Sڤ000S00  $;h0 ph00|`00Xpp~P``wH|@l4g xpeԶXeedd@-Mm@0@00Ѝ@/ O-pMr   @p 0 0P0 D0 p~Ѝh0S6 Y E6  X;S 0S 000Sڴ0 :h0m1P0m1400 l0 pPyHLP8PHP =pH,XH=P00 p0SppWZ (,80S&VppW 3003/`PU 0S00`\Ѝ800 2/d000`000X3pT0S9 HEO?o2 000000$HP 2p03/0S] 8PHP p `H 8PHP pH00000h2p00T2p03/H2H003/0P0 0 0p 0P@ 0H0 HP00iHP3 0+1p03/0SB 8PHPb p `Hq03/P8HPT v0p`H0 000_P1p00(, p8 HeP( 0p03/0S `03/0`00003/P8HP >0p`H00)8   ,0 p004PWxTS4`+T0@0P 8/0/(/ //X|OC-CMMPD<T  PDCލЍCP `p0P 0  Px0  P 1/ 03/CލЍ@P  n0P`00P03/ ;0 P0S (QPD @l- Me000 Ѝ- Ma000 ЍO-0POM RQPPPOߍP *PQ [R]0P 0@@T 8x 080@ P0  D.Q R P@`NB0S  0 S S S,SQR V0B.QL 0.S BRU Z:0 ,R00 ,R RR 0 / 0*0P@ 0G 0Y 0= P (  0#P( P0 ( Z  " 0c2/# SOU  Q.R vP PC oP 0EY0(000 P !R  0  R00  0P(  P|[ KPu R N?0b !S1S0#s01g ^Rc0Sh O-Pp   S00 Cr P :S&0@p0 S!00C| ^ :S0L| ^00C~ X@1 xnsrrY<ԱTQQ ucRPFRv^ P}^`PTVebBb!B `F@0pSWXm`Ȑ 8 P|` VzS `_10</X,10$PPPU 'X P $PU 0#Q0 p0 0$P*T+A+QB` j j0s v z Q@  0;Pj0 Kv00` 0<S]00@~@-@M@)P0SЍ@-p- MlP+ ЍA-EMT0P@p!%@TR% W QP Ѝ P @ЍWA-P0`0 M@p0P\V  K P `rP*- Ѝ=P@0S6 H0ЍA/@Qr0/Q= % P Q _V` 00=0HPv VU 0S  >`d0T0  0+`P 0 480@-@0PM0P0 0P00P00P0Ѝ0A-M\7@ @Pp  @P Ѝ  @PP0 0P0 0 0`0@ QP0@ P@0 00S 0H` 0Ѝ 0  -- M0 0 ЍЍ/O-0MS00 P  D0 Se@0S0pD o`x  P@@@ 0  /0  y"P( 0L`  P6/PYPU@0@S D@SFP2 @ P00P0 ߍ00 ?  j QP P R 0pP0 000000D00A0D0@p0 /80- M\ 000 ЍP/0S/ @-@ B  M0 QP  P 0S 0C0 Ѝ 0 P0/@-@ P0NX 0S /0-0 M00D0P Ѝp@-@`808 0P03/0`3/0`p@/G-`pxPP W\0  Q  @.Q* Q.SS+@0W\0  Q .QT Q \` 0CLSA= Q`\0@W(  QS Se S8 S S\@W?  Q .Q0D  \F!P @W\0S*!0  7! 000\ S  R%X4 \0 S0@W\0  Q0@W\0 0WSQ 0G  G!  0C !P 0@W\0u   P S W\  0 Q@S} @wS p@-@0P,0PPx03/ 0x p@/d4@-@wP  @ (0@-PL@ MwP 0 X0?o20 Ѝ0Tp@-P$@~wPp p@q@-@Mpw0P) 00[0D R$0 S S'0 \ \0  @ 0| S S 0CSP BR00mЍ0( d B20@-T@ MP+wP `0  Ѝ0@} Ѝ0X{0@-PxM@ w GQ P0 <  aЍ0  Ѝ0@YЍ0D$-  M 0vP 0 S XQ/ S S  Ѝ0-S X0S$ 0+S 0+S*0 0 Ѝ0OS0KS+0 0EQRQRQS 0.SA-PtpCh`@P` UT0`03/00 2/000p@-0 0 @P` 2/ P `0`06CP 03/ P 0000>vPpp茫LD0@-PL@ MTvP 0 X0?o20 Ѝ0P0@-@P@ M B KLP 0@@ CP CPx |00|0 00l rP @0S+[  :6S 4)@ rP 0*[0H +[|00|0:6S  P 0SX0@ꤕ0  0rP $0 d1%0Pw$ R RV 0~rP0"N4vrPX0nrPX0frP X0 DY3 SR UR  Y,  0P0#| Y |  $  x4@3"I Y Br R@ Br R3"@ T "P3 $ T' I( (  80PX0S p|r`P$  PP<3001 $0.P$0S[X0Sk  0V@Q 0 D0   0 70P e0@0pqP 0X0X0_L20 qP0X0+[< :6St( 0qP 0X0|0} 0# 90\(~00 ~0?P r TR "LQ SR~00~0X0M0~0 $ eqP 1!0 0PK XqP* 0X0X0@$ SR EQ RR|00|0X0J-+@TdPh D$xLdA-`81M0p qQ@PP?  R ?0x003/0x0Ѝ1  PpP 0 0 IPpP 0tX0p`P X0S 0 @X00S0P0SЍLbtO--$Mq>@ f~P0V圦`t4S4 0i4 R00# 0  03@S3 0 {  `6x&S|Ƅ@ Phg`垆 0`Fv`a8Ws0v^ PS<7 S@#.᠁0Cs@!01 {00!8PP<P "R0L AHk A{{ Q$Ѝ"20S- $+40 P#0 A2@S1 0 1P0m0!/ 0 \ Ġ  P, 0 q"20S- $+40 # 0Q0 @00 &2"0S- $+40à# R#͌ J0 0&Ƅ \,  0xD0 S<0 01$  $ ! @@Z{c@B7AA-R@ MlP1T0(0!1pS00`!  pЍt!`!20.P!`  p Ѝ.000A$>22Ϡ %012c A 0T 1#0Ϡ 0,όC1 ,\ 001,? l P  PЍH0000Ѝ@~Q[&Lp@-T2@P0P`M+82P0P0S$0R0bQ %2R0n1P0a!A4_(  E!KAU@ Ѝp!@ zЍpU1 OAA_,@N@N0<@AAd17cN4PER\ 0C$Ņ!@0?@ 0 @R0 $J FEZ @P@Ѝp J FAZ@ 4x A9_( + OT AA_@ ! 㙙@ 'LPȿ̿70 0/O- <|{{{@0A@0C=j>C9i>581 A;+|3/X@@0S S $@0S $@0f0p&)7 x*|:)7070 S &6Rhl@"x&|6RlfhVH`0&R0@ptHU0 $0h0l0Z &6RfVP`0%R0HPU0 0`0d0H @ Z 0  P PQ0B Q 0Hp@|0H H 0Pt&P0 l``h&00 S10C0`0 h$ R0 \00X0Z  \0`Q M I E AP p<@040P0800H0,0h0(p0l0$0`0 0d0 0%b 0P`0d0h0l0 0Z &6Rhl@UD"210X0 0  ͌0  0 0`0d0H0K`%:PP"60 0%$0Ϡ! d"%>0!!!0C 0@ V8Ÿ?#̂0/  0"!/C1#`%:HP!60 0%$0Ϡ! !%>0!!!0C 0 V1<#΂0/  0"!/C1 0Pm  0Pb ,:60 0.$0Ϡ.> ! 0!!!0C 0X ?#"?0 0"!/C1U0 P&`0l0 0@B'x(GzGQ(\)\0@-0@ M `6KPP' ' Ѝ0 b0 i΀g A707/p@-M X1A0@ Q mn`qN@ P00 00Ѝpqn orN@Fr>mN 0 q>07 07r>0 S6&0 6&nnnn`on7  0l7on`sN.70@-@P M  Ѝ0 G-@@T$PQ p`!0S0 00P Y0 PP0 SH002=P01 ? S㥛 j A/@- M1!@01!0 Ѝjn 0l R0k>ͱƱFñ1!0 m p0( R0i>gNC Ѝ 0@-0@M78{q>j.f^̈́  {{{{'& 'Ѝ0@ g /S  0& !'6/S  0h& 'l6/ /0@-P M 9 Ѝ0@0@-P M  Ѝ0@*@-PR M @` fP U 1 #0S,ĠPU@ Ѝ+O-0SM"0B@ Pp APT 1 #0p0\#4@T p 0 9Ѝ+@Ѝ@ЍA-R`M @p0s P ЍH """b0C4  0000CW`00ЍC!0@-OP@-P0Mp(@01 BQ0 0 0(OP Ѝ0 0P 2 (000 OP (00S0@00(00SU0C 0y 0 0(S0! j (00S C(0 00@?o`2UOP V @-@0MB00 $0(( E  XQ Q Ѝ@VO0E6  X;S 0S% (E  Q XQ QT Q X;S 0S$ 긮̭ĭHC-@PM> 0S; P* NPU0`0 SU .0`0`S- Ѝ0 R1!  0PY0 Y B B  R 2PPQЍЍ0 pLP# 0 E6  X;S 0Sh ; ЍC2ЍC{N000 0P 0S T@-M@P0S0 00Ѝ p@-0@4{ M{ ({+ {40(0,0004x0(P0P` 0 04 X000ЍpX4$p0R 0 4Ѝp0@-@PMЍ0@R@-@ `+p@-0 0 @0P3/00K0*{ 0{{!!""#$(X004Lx|E&#< 0-?0pX \t p@-P0P 0@ 0P3/ 0 p@Xip@xs0/00*0S// 0M- M0P0  ЍM Ѝ0/00*0S - 0 MsM p Ѝ/0bP0 Ѝ- 0M  vQPЍOP0  0 NP 0  0PQP0 h@-@PM7 0S4  P`P"PU  0lP#000PЍ0S:0 00000QP0`PEPЍPЍ0 /0- M00 *  Ѝ0 +00 /0- M00 *  Ѝ~0000/o@-M @0@00Ѝ@/Lo- M 0H Ѝ0@-P`@ MZg0P 0u*0R **R *  Ѝ0p@-P M@ RR Q % R T 1 # P0000V0  _00Ѝ0V0SA 0  JЍO  ჾP1 0@D0T0 )xV q`P 0@D0T0 f0  EP  ^l W GP00008HpL C-pMP`bb0@P 0w 00V00e s0H 0S000X0 W 5 SW0ST000ЍVI 0 + 0 00 0NP<0 0p`F00006l0S0 000&0 P  0S  `F 00 0rP0 0p`F V 0S000R5 S ЍV  ЍHtC-@P $MHP 0X!.0 Pp0 ⍿!0PZ00:$Ѝ %P' @@u@ R? ;R R  0;S S B0eV>  僾 PȻP X0 ]#@ P 0 00S @@;d `P0V8V 1U1P00 ` 0 0 0uP U E6  X;S 0S$ 9|-!!KP 0@^ n`*] P@S QR0!,![ 0<P U E6  X;S 0SD 0@ꈒ ,ȑԏG-`p@TPpM 0 B0S Q(       R @TM: B ЍW R<0S03P E NSc! 02/0PY 2/0PM ! z v 0P ! 2/0 P 0 2/0S 00 Q0p0 B B!0ۻ0 B BԻ XQ QPQ@0 00 003/4ULA-`0P`0dP0@3/0P  !p 0 80003/ 00pP 0RL@-@0PM+ Q)  Q% ~ R!@0g0P r     0QЍR  Ѝ@tpOPC-M~#< pPPq `@@AA` @| a qapp` Pv 0Y"w Q0Y"y 10A:Ѝ| p q P@ @ P@ PЍC 0QR000 0 /00/- H  0 M 40 2/0   ЍPO@- S@M* 00ЍP0A-`PpP 000'S 0^A0N ! Bs B 0C T000PP0^ *0 A紀 SP 0 0/G-Y7 p`@PPE00)S ^! 0P0@ ! Bs B 0C Q000@Y0P*ⴠS 0 0R A 0R-0 0  0S:䭹@-h0h 0  2/@P 0   0S:㒹KL0@-@ P M  01/0 00P \ 0 2/000 0A  0S:Ѝ@`tKp@-@P `V  0 ```  0S:p@? ! 0 `  0S:p@$R$+/-\R0# 0+pC-PPP4 0`003/@P. P   B S 1  P00 S 008  @ 2/ppCI@|IL@-@0S LP ^ 0000 0000 00P/0-L0S ^ p@-@L0T0pP< ` 0 03/03/@TpGp@-@L0T0pP< ` 0  03/03/@Tp4G////// k {ʒ0*k{ /0, /0/0,//  //0P/R0 /00/P R0/0S:0C0//@-@ MPp ` E6  Q ` 0  Ѝ@/00 2  ЍC-`0% @P,Mp W G& P,Ѝ  T W] H R^~ppt|w x |pW\WH\L@$D\:Q  x0 |0x 0|0PPY 0E6  X;S 0S gag`f `u  0 W 0 Q H P 5/PT E6  X;S 0S300S| H0P,tQPvE6  X;S 0S ڌ200Sڀ H0\0_o0R0QPpH\HppkQ{W QZ p P 5/E6P  X;S 0S100S;U_ )HpP 1 pH0S0g`t= ?Px R|QRWp!H\  ppH"hlR $ Q0Pp& H0PPYE6  X;S 0S t000St H0P8000S< H0xD~`}}|{{`{${O-BM0M1S` pp 0h1/[* [ 6ڍЍ0 0 0 ;/@KP WT 0V:p0zp0 S0S S0 ڍЍ0 0\1Lz0G-@ß,p0(M ,OE \ $0 PPR`HRzQpB c 0 KP0Sp@-0M0P3/``0* C6;@0$ 04003/@P 0  0  @咼0P  02/@  2/0Ѝp0003/0(LpC-a`@0M03/PP/ 0 00P0\00: 0:00"PE6  X;S 0St000SЍpX 0P( Ѝp40P003/TЍp'LPfp@-@Pp0M0`aPT0Ѝp  2/  2/0Ѝp&@-P1\0@`pM 0( 00 (0P0 0 ]0P( \0 00( (  0 0Ѝ(&dp@-@0T0M! P`@T 003/0P E&  X+R  R <   R,0~ 00Ѝp$c0@-P0P0@0 M3/P  T0000 ) Ѝ0@ 0003/ Ѝ0<$L@-Q1P0@p0 M`3/P. 0 00 000p`0T E&  X+R  Rd   R ЍH 0 0 Ѝ$0003/0#LdbQ 00//QQ 0S00//Q Q \-//p@-@T P0 03/Pp@Tpp@-@T P0 03/Pp@Tpp@-@TpP`0 $03/@TpP/0S/P/0p@-PP0( `P00 TP,ᵱ@PᬰP0 S pGP 0L 00GPp+p0L 000@-@M` P@P0 0 pၰl P+00 0 GP <0@03/ 0 3/ 00Ѝzp@-xPx0P0@0`3/0V0 RD0P <0003/P pp+pPz@-d=d'A`͟0A`@PIM Q 0Iߍ;0 = 0`03/ ;*0;0 3/0V 5IߍR P+ Iߍ@R RR0R00 0  0 P<0 02/0 2/ 00$3/ 04|!MR ǯ;PT $0PT;T 00T;SSS SQ QI  h!R $1sq S"0P * 0 2/05 1=&ST!hL!fOtRa `UP  ? PK QN ^㛢PGW. CRA 0S> QP!Iߍ@dG@Q Iߍ@O 5; T9 003/ ;*0;  5:! OXPS8$R 0S N !&V`%H6 R 00H6 8P K JJJI "P  &U G60G6UPKr   PKe G   \! %%%PJ G KMIG60ϡP5  RUW G6@0G6SR05f [Iߍ@R[05Xd!VWt5S015x!Jp!HT6S U VP&屫0P770堭07W? ;Q8O$C6 R 03C6; ,5 003/ ;*0; 5:4!003/ 0%=6V X6S VPU X嵰!I0P  U  F FP  MrPB6P&3PP !GF   0 0 0!PP p 030`03/03/u!:20`U= 20$`03/0R.0 $0LP-   5|[0P>  EP#QW PX_弬L0WS 0SIeoYE10`W 0(3/ 0 R.(5 FYPTT 嘬L0T[SA 0S> 0P6"l0P U NP%P&R. 0P   ᑪ0PP 0 006PP 00P "0PP'Gz[(RXR@p@-P0P0`0@3/0T0 0| Sp   2/PP  Ppp+p 藬 z Qr0;S Co@ \"((R#PS0< A0/+/@-@ϟ T `P0M4/T/T/Tm0LD`?c@D0T@ t/T *h/TO T*& BTU xc BTU S TI0$6@Ѝ?TD 0@Ѝ0pS DpR"  TN BT' 'D'A! .Tr T0S0t>000d.D QQ D.T  T@  Ѝ@00 >T 0CT=uLD@D0T@@ -TH BT-NLD @DGT@@ -T04D BT C BT , T - BT0S (1v r~@Py E6=&0 E6%@= 0^03/ 0 hE&0E6 =< 0^03/ 0 LYЍ@YZZYZ@ŞPY @5@㼞P Z R!!R!R@D$q0!q0 ! q0 1S$105P $!S0=6C&S C&E&  X+R  R IH&S !H&0-P H&0 "SH&H&S  H&H&S "H&B&S !B&H&S !H&B&S "B&G&S  G&D&S@ #D&#0  #Y0S#0 G&S "G&G&S@ #G&zG&S "G&sE&S #E&mr }E&S@ #E&dSb E&S E&=Z#0 #D&S  D&^LB&S #B&WEF&S  F&P>E&S  E&7D&S D&B0F&S F&;)F&S !F&4"D&S !D&-#S !## !#"oF& !SF&oF& "SF&F&S "F& S E&S E&=C&S@ #C&C&S "C&C&S "C&E&S !E&dC&S !C&#0  nC&S !C&C&S  C&E&S "E&CE&S E&<'S  'E E/ S=D&S "D&0PZ #0  S#D&S !D&zD&S "D&sD&S #D&~lF&S #F&weF&S@ #F&p^G&S G&iW0宙P$ # !G&S !G&ZHG&S !G&SA Ts _;^R: BoPP#88S#Q-R <0A )0S<1 707!0X1001010P10H10505 05 s/1!S1+@S1SA6ŕS86ŕD3S<6ŕS/5% 4 S/"!1S XP Ѝ@S6" !   @   3$S*c^0s/1!S/"%5@6S6S/5%0%Pb 0s 4H&? #H&B&0 1B6S~/"!1z. T6SuTPTq@xSl/@4D$iSf/"($,4b$1003/05Ѝ@ԖS S@[PSN/"%5JSG0(6EsB  t S b^ ;'N/u?t'(>v'7'!@('(uN'JV'''z~0ONs $!OQ %P 1$AS*A^0S96ŕS  QD(0 !!D(S <#0 S4ŕS S 6 S;04S/"%5S  QT(0 !!T(S <#0 S?6ŕ C R555S!c^S0S005S0;6 S`45:S/5%S/5%SR4ŕS  B6000B6S*ᚩc^|Sy*ᓩc^uSP4ŕrpSQ4ŕnlS:6ŕjhB&0@ 3B6cS`#b^S [" !   @   3#BS6?=S6;9S7/H4L$4:2:0S-S6 S944(#TT  Tj0\4T0u $Tp  TT4 L @R  7L0P&Q P&T&Q T& f  B 40L0T 4RL@ L0S  L0  Q  PL0 P&0S eBSL00T6 083D%TG OLD;@DT\% T@@ 0`10t10l10 60<3:0<40@31X4%T,  T& $ BT0@1>0{M0 wML00,10S81`7070 60S41$ B60B6w0D1t0P@ 003k=P Sxe6 003/0 51[70B&7 B&041OS=^K>6IeRE0:P0Xhl'0 2/ 0%!)-@-0P+0M @ +P0 Ѝ@ Ѝ/ Y07@-M@ᡥP Ц 弤P ЍT@-@ H@A-P`p~@P ᜤP  7 -ΦȦ@-@0@00M3/0P  t h0L0P + +Ѝ$0003/0ЍpLz~-p@-@P M 1 RPUP !0  0CS-0 P Ѝp@ Ѝ/00000000 00`10 @R   81 0` BR  P0S QP 00P ~00`0g0   060P R0PP0SQP0S Pz~vղp@-a@P`/ 0 R+ PU  05/PU#0 )hKL/jQP 400370S  3/ \0 003/pPp0S  3/P z~L0S @-@ \ 00P2  " P+10 0\S/S1/0 0`03/ 0S / 0H PP 000S \/S0SЍ Ѝ\ 0,PP 03/4 P L ,H+*@-@P$0Mp`$ & A PP0E( P4  / "$ !$ "$! $ "$ 04 PϢ40$ 0$ 8+P0 R"0(0Ѝx*G-0T@BMpĢ P P ` V? l    \ 0 ^@P&ĠP@u0  ` Bލp)T)O-JMM E@PTPPh 僢`倢`Sp W?] P0 08 8h ‰ 0PPPPPP$   h  0000 0PP 0PP 0 0 t P P # X  Pp`۟ps0't `p JލЍ((''X'A-`PPM"E<@PT  0& 0S&  PQPf0S RB R=  $ ( ,c !04 1 0400Ѝp P 0 #PQP0P 001 00r00P00  0 0044 PR"  $ ( ,IM  54 $670(<00P00  0Ѝ0C0|&|&آG-MM po0 S?$P0  0兟 !+ 0 R 4   8 !! E0$ ` CG#44P!F00 P`4ݍЍG-P @0MQDp6PW0X ;` :S(0S  U0PKP00 PQPEQ6 0T'0C S0 04 8 < N0 0 04 8 <&SN0 0 04 q0`0S P`00Ѝ0!00Ѝ00Ѝ 04 8  *(? *,@ ($<: $ +=9s/   A 0 T$(E@ / "$ ! "$!  "$  0$ D (0PT0`DSD ("C 04 8 <7401S4/  10S 4  R L8 470"0 04  0 `080 040cS+ *040; 00*sa `0]4\ $b8^(c<_S,&0 0C6 I0HM J0L04K  N 8O !1R0̛ 1R01;_? ˢ10;0400 0*000"0&0.00!  0T1000 40 80,4*0,8 +0,<  ,0.0)[`0 $  40`0|> &\hl0x |4  0t P0F 4 F040cꀖ8#8#" !$>ޱoI0000/x/p@-@l p0PR0Pl@pE  XQ Q000S 0 0!1k884@-@ BP  @ c,p@-P<1<0M@` APA  R T E6  X;S 0S000S)Ѝp1  P0 0 ,P l0S 0 *l00S0P0S,Ѝph0 0@-@PP MA0P0  l0?o20 Ѝ0|p@-P$@APp p@z@-@MyA0P) 00d0D R$0 S S'0 \ \0  @ 0| S S 0CSP BR00vЍ0( m B[0@-T@ MP4AP i0  Ѝ0@ Ѝ0|0@-PxM@ A PQ P0 <  jЍ0  Ѝ0@bЍ0hH-D$M0 @0PS 0A Q0A Q 0A ^ ^ S+ -^ $ЍS  0  P0( S00l0SS0( 000$0  0 0 Ᶎp@-t0@PM XP _Ѝp 0XP0S XJЍp IvO-@80p$M P0L 0婧P0U `H 080G00L 0$ЍP`ᔧP 0000 0`P8 0 00 80R@ 00S  ᣝ Pq бP`P 000 P `R00S2 P000V0P 8  8 H0ݧ`80RP B0⒧`P80 00S+ S%  0₧`P~  F0yP0  r0P*R00 *  L @ `g`eH0 L0``Hxl@ 0@-0 Ω@-P0P0@p`x0 M3/ P 00t?P 03/ P 00P P  T E6  X;S 0ST000S Ѝ8   Ѝ0Lh4lp@-@0P,0PPp03/ 0p p@/A-P0` 00 0<Rp3/@P" 0<S (P @0>S00@#P0 000x@>œP00-0AMS M 0p  Aލ Ѝ0  0 P  @-0,M0 @0`p0 PPP@ 0R  05@ 0l0003/T ,Ѝ ,Ѝ0  0 0@Qt@-Ÿ@S `04M? R pP R 0  CP0t0P1 $0Sb (PY $2$"0 -t ; "  " P0S 4Ѝ 0804ЍR/ R) ! 0(P% |1|!0 p!0 00T! 0 2/080创P0! 10 100 0 wP(P 0 0 wP( P 0 0 0 P0 pp 0 8 P \`O    t NN< 0  DN (NN G-@M=ptpP WP P`P= H1003/0Y0 B64$6S1 ;QU lPU 0 l0P0S0P0S P00E6  X;S 0Sh000SЍ PD 0 PЍPЍx   O-P,Mr=@W 0PT 0N l0S% 0SM9尙0 `0  0`P9l0 S Z Z/ l00C S$0 01D0QJ c\ m 0S0  ym $0XP $0S Sc l0S_ ,Ѝ@0SZ :6S l @ ,Ѝ0JcS@  00JcS:6SP 0'6p0 CP l0 0JcSnt0'0t0p0 ,P l0 Z ዱ[l0S PZ7Z,> !0JcS*0000 R E 0JcS$ Zlr 0C Sf00 X O7 ,ЍB6,  B < 6 ,Ѝ%ZZA  Z!0 5%0 P2 l0P'l0S`$L P P,50401 $0kP $ Rl0Sc\QZ  0 0DZ JR0U 0備P0t00t0 0S@ :6S>  P9t0:6S3 0 E0ח0 0@0S x s Z  L  Q RSQ R 8 &Pt0 Z0t0 $ 3  P3"J Z Br RP Br R3"P U SPt2 $ R& JP@CT 2' -0 SR&  0јP  ʘPKt0 J0t0  P  ;t00t03 IR ZR ERt00t0&t 崶  t !帶p0 zP P0 0 eP l0BIQIZQFEQC,bp)  \@-1P0 Mp@`P & :0P 0  ' Pl?o20Q0SE6  X;S 0SX000S Ѝ<0   Z 꼼hxO-\9pX0@DM:<`f0PV0 00 PP 0 0  0 P DЍ 0& 0: 0 0A0 1E6  X;S 0S\800S'00 0 $6   0+M!RJ u P$:0`P 0  ᇿl0 ?o20 E6  X;S 0SX700SR0S E6  X;S 0S7P0S0S0 : {$&R <5S* 60 00,0(,0 (zP)t0(0$0 40Se 0$08 ,0R H*460 003/ &0  2/0%$00 00S @%R 6SoQ0 1r0 1*0 0e P0 0 `0$ 3/ 03/03/$ E6  XQ{ Qit0So 2lRg >  Pt0 *:R00 $0S0S P@s@T00S@P p0$00P$00 00 PJ 0Q $ $ 0S3003/[0 0l3P0Sڬ0 `E6  X;S 0Sʘl j>Q 00 @ 0 P[ } 20\t " $Q " 00* 03/ 03/03/ RB d\ 0P0d $ P]b>B10 00 0010 00,0 ,0( (7Pi$0(St0 40S@ 0$08 ,0R' x 003/LPۓ0P0' t4! (10rP 8r0 s0$0 弓0؍ P qP 8q0 s0$0꘻(``=`x$8XX8L77G-p 8PP^ @0x!x!t1t!0 XL0H )0P( 00aS`# =S@ 0S=SS6 0S;S KP@ J@0;S T0S @P p7PP@ 0 l0@?o20@0$@-@(0Qp00c0 h P   -P M0 2/ 0 00 Ѝ/00/ᠯ<\/-, M 2/ 0 Ѝ(0@-@ 0R0 0MЍ0P Q 8031 0 !Ѝ00- R R P 8/00^ hd" 0p@-@PM `"`0 P QR 7d0 Ѝp 0S `"A0`2ЍpX,p@-`0@PM  00`" P QR d0 Ѝp 0S `"A0`2ЍppϟO- 0M@ 00`P3/0Ppn Rp U R  ! d" h" l"0p2 0 0 ?0 BR  0 X2 E6  X;S 0S00SZ >0 ! h" d"x. uA?h"0ZB4 0X  0d28`ڏ 0$d  0(ҏ R] 0`VY*ඏ07pd" P 0S000di/4/0МЍ0R 81!c P$@-@R,MD 0 p`0 0!`Q* 0S' !VP000@S& @`0S !BQ@p@000@S @0000  0,Ѝ0@-@ M0R' !` 00 0` 0@ @ Ѝ!0Q `D 00`@ @ Ѝ00R@-p M0R@ 00v@!Q00T `@@ @ 0 00 Ѝ@0 Ѝ8R@-PP M @0`0!Ḏ 0S 0 @P Ѝ 9T0T   00 R 0"0 0 0Q//00/P 000/PR/0A @ 0000S/Q/PR/4A @ 00100S/Q/Q@-xp@-@: ӈ P 0P0p@0/ᬃO-P` MpP( k`p :@PP eaЍ0S3 pY00 STpW LZP ` 0崡P  G7@Ѝ0 0~ 0@`?oV20#S o@᪢4A-PX+@RM  R <Q ' 0 0Sz C0p 0SESR` D R X+R Pd0E'V0 R X+R P '  !0E0 'SR X+R  Ru& !E  X+R 0SeڜE& 0'S`R X+R  R\ 0SyWEE6 B X;S 0S<0 ?/s0r ЍA/E6 , X;S 0S&ЍA~E& #S 'S S WeP`0HE&  X+R  R 0a0PUЍ$% F0'S (CqQ0 R X+R  R$ !=0FPR0'S Cr Rx1"t R  E&  X+R  R40#SV 'S0SE6  X+R 0SWP0HR Q XQ Qڜ00U  ER Q X+R  RL00E& W X+R  RQ0E& H'S 'SJS #SF00E6 Y X;S 0SS ЍAR| X+R  Rvl"l !0R` X+R Pn0 0E0 X+R  R}0eX+R QUq0YX+R \Fڜ! ! 0`E0 Qm X+R  RgP0O0`'Sw CPR X+R 0S101 7n'VFPR X+R  Rڬ #Z'SN'SZxhxMh @vK?`~hsh0r,rG,0@-PBXK M\K ,QP'S 10 ^ T 0S0 Ѝ0S# T 0S0 Ѝ0C\T 0Sڈ0 0 10 Ѝ0@hPP`PPXT  R 80PP;$p8ptND@0p@-P`@M9 P`P E6  40 Ѝp݆ HR/0A-`K<,,0\ P':0 ʁ0.,^E& p >. 99 庆P*0/ 9 3⮆P0A 0ʁ-<,.,> 03/?/,1<"$#40,2<405 ꉆ DO-E6MJ p,Δ M 0>+ 0C<, 0,Δ0,>P#U 'U) U ލ ЍL 0 "0  @P(⌃9( NPE6  >0* ލ Ѝ  ,"(`P0 n\U{ 2@0010 0$p C0 00 0  0 pU@PU pᙅPd,ᖆ0P  p>P@U$pdP08!0 009 P+E6  0> bލ Ѝ Lg 0 0  @P( 9( ͅP~Džt 2w\ +깅D $iP@(< O-@`.AM> $M`0t0 3/PPPj {T嶃 LL> ˅ ,p,,~ h d0h` `hPPP pPPJ ;S 00C9 R- `♂ `E`P0l8 8ZL xmP`= ؅P( ;0S 0@0CPS0 F҅F 0,5P5üPP Aݍ$Ѝ 1P 0<  P 0\h8ZPB6d 0`` 张F FY  cp PFF; 0V8 *0F QPPA PPU 0P0 0P0PP0S 40(``,,8z $ 8P< PS00 0@ P$`0ZV z*:7/Ppp P W5%0Z-P *Ph  P0Pk\ H  P 0 \8i  }P  SP~ 0 8X  lP  P084G0V *4p P㴠FT/0 A$ r (0F P P0(`+PAݍ$ЍU,>V UK ,P , ,>P ,.PÅ,>0C0>;,0,>E6  0 l8 E0R  U U0<$0s `Z7$ 0r408P(`0S:  R7$``J PpP@$R P(Up@" Up(P@R0S S S0 0E6  H0 V001 R R R 0<U0< ,>, S 2,.5P50U<$0s?0$0E6  0 %001,R R R xE6  $0  1 R R R(R2 *(R$  YE6  0 1,R R R*$R,  ; Pl 0<80<50<;,0,>/0<,$0s0<'$`%0<"0 +PP0 00 0傺k 0HP`P!E%0$PPx᪂P < ^(Y8PP0#`⧂P P`;(, R , Å0<,P , ,>P , Å,>0C0>;,0,>5 R R,00 R  R 0 0,$R R  $$R R   R R 0 0z R R , $R R  $$RK R :0C Pi P$ (0F P 0P(`<S3 S- Sb0 <9[  3 T  <0(<0:8Sy4S$>4S049:8Sj0S 20S00-0ⶀX   X ,@1S5 D1S' λc< `8 41SP. 02#1 (T}P%101/00Bߍ03/PDPBߍ0 3/P @ D1SPBߍ~,w$ PhXLؼx0@-0P M2@ }0P  AP; NP@0; Ѝ0@0; Ѝ0Lj}0P Ѝ0LPPx0@0P cp bp*/J/G/E/F/H/I//D/*/Xp@-P @ᔴ0PT dp p@p*ppO-4P0;@@KMtp40Q tp0 0S0ʯ;D!0 00 D1 *:sr0$ 000W P$0 0}4`}0A@V0  pD# ){$s}B&0 `p+  * pr  h#@ (0{04! R(p:8ßD!  0J}0 0 41`S: D+}2@0 81z41 S:D!20'} 0 41S: D } 0@z41 Si:D!02 0  }4! 00R[: D 0|`ۮP ' 000 DzV c},(& |1$003/ KߍOKߍO00 Kߍ; a 0 00 D1 Ḵ @81 bz @0 \z0$003/G | @0HzX @81 AzTĸPDH8<(0 0@-R  \ E6  X;S 0ST T  t@@n@$ $  9GдxO-PKMYp@Ppp /o"IQ|$0 0P 0 Sp9 PpKߍb 0 0|$pP0S00004!@ 0 0x 0P,(1@!40~ N^ b|,(%` 0 0D0 0 @PP  P*p<`p W41`*3ԓԳ0 0 P&(0#${P( 0 R081SV4! E  XQ Q4pW*@H |P P@ T0 D 0{P 0 P @PTw:r{00V$0 E&  X+R  R u xP xP 0 ";(@ 1${P( 0f E  XQ QJ0( (0`@?ps0 0{PP @VME6 J X;S 0SDH (>P< O?0?qs0Q30@ )pP, Gp 0 0 0 t$ ` ` ꘳Աܲȱ` Tp@-M@i00#P00SЍẲP*00{0Ѝ@lA-p`pP@000P `P 0S P1dp AsP0PGP p@-P !  `80\^   @hl0#\ 0s0000s000E6 pX;S 0SpL000Sp</p@0 18@Gԭp@-AT `P wP 0:0CSp@TpQ D#R -0< MP R Ѝ/E&  X+R  Rp00, , ЍRE&  X+R  R00AA0P 0S  /+; B/o4"01ʀ;/A-@ 8dP`6 S 4003/0, }xP;^! 5R: 1!0PC6!0@ 00+? 0;;(0;=6W;W,+d3 +! 8(!H(0p03/;[S SS4>:S< M PL(U7 5S 0t 3/wPt Qb ;00;Um 00 h2 003/;0;$1 !:sr00*P00S !yZ (;@0;;D0?<(8 ;<(L8H(0L8 [UD 0SP 03/`03/0`3/`P9T'5PSQ5SS4P>.BonkPPfPP$aPP([P|0$003/PP Pt5S ;00;h4+Pf5S^DȪȨL0p@-@M0!; P 1!L08 x 00| 01!`@03 ,% R- 'R '>E  XQ Q0x0  0 2/P ᥵!@01Ѝp!L + E&  X+R  R\0L0+ +8 0 07'@{ - M{ Ѝ - M  Ѝ{- M { Ѝ - M   Ѝ00/A- Pp4@`TM 4/@T00S000E6  X;S 0Sx000SЍR@@T0 V @(0 @Ѝ=0D-8^ /0峦0@-0 M@QP P 0 R ;0 ;+Ѝ0 0-0Đ  M ^001 0! Ѝ@-0 P2000Co/#2P/O-0 0 vf`0g ` , PP2yP  P R`e $|$`_ ` Pvg0, `[(;``T`/ /Q0 00/- 0 M0fP Ѝ ЍK@-Q0 M  @ Ѝ P0 0@0p@-Y^@TpY^PX^0@ Sp0000/Aqp@-?C?0`!CS`M |0P003/0P Q  0T 1!t8  2/0  Ѝp2L@-,0, 00@03/0000p1p@-PU @aP@D`F0 NxPVp  R *010C R   // R/0- M!0r 0 Ѝ !R@-@`!3?Q AqV" `a>&  0/0!S/p@-!#? 0A@a Pa3<500p0!#!S 0?10 a0 A3//0@- @ RP M*010C R   w0 30 Ѝ0 00 Ѝ00 p@-0#^M!#SA? `a0 `A<<P^P^ @ w3 0Ѝp00Ѝp 0w0 00Ѝp0 0 0/@-p aR`P@ M1  u 1S0S  RQ  R 02/0p Ѝ00 03/P  0p 0@ 040 003/P  Ѝ-L 0R01 p@-@MP` u 1S0S  R  Q B   R 02/0  ,0003/ЍpЍp/,0S @-M@0eu01S0S  R0Ѝ/G-P P ' 0S' p A aT 0 0CQ 0 0S 3/03/@T0Y:03/00000p,+ /A-pP0QSP`PAT  5/P@TP00  qp@-@@0T0` 0 P@03/Tp@0  q)A-PP p@ `0 avpVPUpP 0    SP//A-`Pp@0 PM@G ( T !:P0S10003/0P7 0 (@ G?"#! 0L l3 0>0 0Ѝ00003/0P U 0P   RP , 0p00Ѝ(LP/ /1P/(0RA-?! 0N. n 3 <10 0P/ :P/(0RA!30!?00 a A3//0@-PP@ M 0   R@T@ Ѝ0 u0(@ C@@ Ѝ0@-PP` M  0PU (@T: 0@ @TP U00 Ѝhu(0300 ЍS$0BS#3 ? pl0  pL11^  1 R   >u 300P0U 1u 00A-Rp1p!W@P`01Q  R 2/01 `0A 0@W0 00 0 /p@-0@Q0+M!  R P  02/0P` Q  T 1!`q 0R D 003/`@Ѝp0$Lp@- @ 4P40P 003/0000 00p#/ /0S0/RQ1 0@-0 0P pS& 0@R1!R00R`V @ 0^ 0Q 0 R/ J0S0P//RQ00 \ -^ @0S \ 000/00SR@-@  0\ *\*^ 00/p@-@P0 0` 03/0 Z3/0 Z3/0 Z3/0 Z3/0 Z3/0 Z3/0 Z3/ ZmZp @-@!1Mx*|:P" ; 0p 003/x*|:h0003/Pp  ; 0;Ѝ ,n;0;hp@-`M@0 P oP0S 0 0spP0 20003/ލpoP V E6  X;S 0Sڐp,@R0 "PO-@4M @@@@~muPPp@ @* ? m0P n`P\pP Z-  cP- 0 㔀 0@0 nP P) 4@`4@03/03/03/03/0 3/l4Ѝ bP{x  `4`@@0 nP P04@P 03/>0-0`P003/`QQ 00`P0T1010 Tn 0S[ $0|#0($oP0 \ 3/@0 An`P60SV03/pp0[S 0p0n0 02`@z#pP  vb0 t Z 0U2003/P`\dpPA  Xb00S|A>`V2 JRb``(`3/VoP @0 mP 0 /R0S 03/ pmP `03/0`00XoP  b0n0p0G0 0 0zpnoP  a0~oPoP  aP0JS00CS 0eh  0`@$T08H #-0 MQ" @Q    G& E&  X+R  RD0v0   Ѝx Ѝ䄁/A-p0 0]`FN P03/TppZN @03/Up; 0 3/+ 0+ * 0 3/;0;@rJcT umTKp@-{>{h{B6=0B6D6C0 0D61%P$r{Ą 4!!bZ0i 5H6` 0H6%ZP PG 嗼P ЍpK␼P H D<  ɠ'{%%%_^0Ą4{{P΄V({ {{>& 0 -@ DH&048 D6H&Ѝp `HQ`}C-LQL1P00M3/@P0/ p1 7`0 G w pw}~! 00P000 00 000| khwy  U ⦑&0P@Ѝ0 khPX 8   2/0ЍdL,1p@-QSP@` 00S !# 3/ T` OL1P03/0`3/0`3/0`3/0`3/0t`3/0t`3/0`3/0`3/0`3/0`3/0L`3/0dL`3/0\d`3/0`\`3/0``3/aXY03/00a3/n0`4 0p@/@-`$Mn P@P @$ЍRE 10&1!0A1<0SV bv1 <03/0 0>v 0S E6  X;S 0S"@-l!1RE  X˕\ \ 0   l ,l!1RE  X˕\ \ 0l |0 v H0S u0 s0 0u 0Xw\v(v2S 1  1@ ?&R \ 0/A-P!.Q@ ` M !P// P 0ЍR !Q// Q! "P5 Q 0fkP!00#1T ! R$ !kP 0!1P L0RP 0! "QTTkP  2"Rݘ0P ! n0P0n!@  0P0 D Q !T 0՘P  0!z  rPnPj0qkP0c  AP!T  "  L QG&E&  R X+R  R 0v0  3!T L !P  !R   Q R  0hP bP0   @!R  0J0P0 0@P0@P 0hjP0 0  0P 0 E6  X;S 0S"PlljP 0!0P 0; PLP4 0@0 0Q 0VP0JPP|| 0jP P P 0 R VP|  00Ps Pm Pg Pa0!/0B P+0- P(P #0P0!GRE X;S 0S?x; 0P P0 1S@)&#Q  !@R `P0& 塟 @Q@ `DxV:@T E6  X;S 0S, '$ `0V`0*V E&  X+R  Rp0 0V E6  X;S 0S$ rpnmmmA-P`Np j6S?0pos1<0S  3/p8pIs ᫛p0ASA-p`@tPXR\000PEH00AT  fP 00S @kL@-@h@@P00//O-p$2 M0: Ph00@S;  ;hT` PTpRF0P@ GA0pP0: PDPEU0 0p ЍPp@M 0P# PGTPE=Up 0P0P) ppGG@~0P 0xpP0 0 R 0p0@03/03/ ЍT0@0DC2:0GPCW0P p 0OpP0H0P P@-@MPp` !@ 0MPv 00Ѝ@-Q@M 101;; 0;0;hP Ѝ!T  0;v 0㙟 0=ЍO-pP\Mpph :oS`p! ?"0 003/@P 0 0020"0ppǤ$hp>$ Q QR00! " 0  B/o0"015S 0S101 Q1n011C6001D1031D10?1?62B6"02(P d?003/P c ? X1!. 0\1 $0>.00 4 6S {pNVdP  4S 0  Pp| *qe P ; $>  03/ ;W0*; +0  e0P CP<0qWflP =003/P TP =003/P XP =003/P G&1#0111mX 8=003/P| [ = 003/P ,Qx pTԋP <03/ 03/03/1011  02 10 103/03/1T0 1010S +@* 5S 03/ < 003/P8 86崀Sp03/0p3/p10186+S0 Q Q Q= ȵpP;0;; S2Q ⺵pP;0;+R 0 dPW0S: 003/P 1T0   ;S\ yp0S 0S @[2 90080:S 1T  ``90X ddpP e 8]c03/80X 8 0:S 10103/101[XP1U1 "2R6 10110S 3/pP>1 0S" 1"l0T04 dPp0| e 1T  Ll, ?3p<@2/pP ppP 1  03/YWYYp\ЍbP N 4*S  0, pPe *H6G2 00?IcpP?0@ #dPE; 7 03/;0;@0:Y 夋P X  t7p03/P 03/Pp}703/p03/03/po w\Ѝbd GP50q@Pp0S+R 0 bP10S\6 003/P cPyȚ dP*0[S 60(00 3/PL TLApP`T6S ePzd+P  L040R p07 403/Xh 1SB 03/[ 0S 1T0T 03/4P03/03/p\Ѝ 03/ 0dp03/W< 03/03/YWMl>ePE ȚY4H0 (000S 1T0[ 0S 0 02p 2/W0 'p0 3/W0St0 !LT  " !p" !S101 101D epP E6  X;S 0S  0,TQn10qqpR  %10?T c0 TP! 1 03/p!0z apP; 0 3/z0@ b0P 0CS ! q@P00qWNR ;0S Q 03/D1003/P Q +cLfHzzkcp^г\tH]@s4ZZ rxYYĮWXpTTU\jj8S^0QlQQdPPQ|PpPPP,O OxfDM0O$ONLpHHHLKKHȐ RdpP3A80:S8 ::dpP` 0 @8mcPa2@D QS8X0SL 0p03/P 0[S 0( :dP 000S0(3/pP I 1/0S10103/X2! !E& 4 X+R  R.0 (!dp lp!E& X101010103/;S ;0S 0 a0P!T     @ vpPM@GpPF;00;;S ;0S 0 xa0P!T     @ QpP(@";pP00;@0 ZaP@(0 03/P^ 0 LaPi @Pn840q1H$@0 ` jcP E6  X;S 0S|ڔ0 ]T403/[ 03/X+R  RY FS0 %2 @_0 @ "`P @HP5S1 010 pW p3/0p0101! !101a0 050(0060;5003/P5003/P`+0603/ S$ 0CS& qh&ॻ;孞S8@P60q6 S' 0CS ' qwpv>pP51 0RH(0-R.  R .0Bs0FR13a BR0]S 0 b E& _ X+R  RY,0,0R0S$ 1T0t;>pP  ;bP% 0 5bP D]bXX VbPl PbP803/ P @P980qcd >pP1s Tlb1P01lnq0)@<;*0;E6  X;S 0S PպQ Q1/: : 0.0G&1 031MpPDE63:B60X 1T0  G6101႗P P0sE6 0; S X;S 0SP;00S`MpPkpP <8 D8 E6  X;S 0Sm0<8D80D8L8 T8 E6  X;S 0S8U0L8T80T8kpPP!堁L0 ?3l,p<1,1 00pP1Tp 0 $0@  Z0 `0 KP E%R0%S E6  X;S 0S_ 0R R A@P0B-B\ Q_R~RQ0  * :`P1L0Sf0@0;a ;^+0 1Lp0@00 2dPP 7@ 0 03/P @0 -dl E&  X+R  R{a@0va@0 @00S! S S0&2> p4T 0 0⧃0P S 86SkE6  X;S 0S4T Se <ǸW $_P1T0  RN 0SJ0SG S|p03/GP50qvp10102S'05S1 #` ^ 03/1p_P\ 1  03/S7S  B_P j_Pe_ R 0S0S S@0L01DPL0H@@ 1  1 DhP +1  R L L 8(  !L   L0 L  H80 1L000L  1L0#300 L0P1@p0 1T0 0S 03/03/0  001!0 01 03/03/03/03/0  00000L3/0dL3/2"d(0 LdL0dLP(0 d\2"03/1\ @0\ \1XE6  X;S 0Sڬ1Z Z 10R |QV @H1 SE6  X;S 0Sx&!T   G&! !S E6  X;S 0S m 900S X;S 0SD0D!T00a7QXp > o[ H$F\)EEDDD$@P@BBPB@Bh@W@-p M`P@]0 P4 P Ѝ\ 5/ Ѝ@-@M\ 4Ѝ@P@-@M\ 4Ѝ@P/PQP/QQQ/p@-@0 0P03/03/03/0 3/03/03/03/03/0 3/0$p@/ 1R0dC-@P$M`Z ER0p 8 %R 2RP 5R\]\B \]\  \]\ ^$Ѝ]\ P 05/P  0 PP 0 lYP0 YP L\@pP]00$ЍP/x AO-S Mp@P0`? R5 x`&P^R   [0U0P0S 0 S CV  Z Z0T?S`` ZP ЍdP ЍR[P 0 /RS 0 /RSH Z PU00P00S @ܐ>>O-`04M@\@P00 0>\$vPpX HPI *P  T0  0000 .P)P 5003/000S |5003/00 0S T5 003/ 0 0 PE bZP dXd 503/03/0 3/0X00 0e 4Ѝ kZ0P[SJ :b\P @ mZ0  0S0SE `ZP PZ0 0$0(0,0 P[RP 0R`@0xS 0  |[P, 0 Rr .R#T!  @0RP 0  V[]\0P 0S :S |@ ` Z%P[P 0 P Y  YP2 003/U Y` YPPw 0[S :XUe0d" [P00S 02(2003/" >YPf80 `!@ 0ISf0 Y$0S(PU* 0UYu%T0 PY0S&  Y$PU* ?Yu0T0u40 %8 tY0 Yx$0Su(PUr, Ro $Y  0 PZY0  0Z& \YP eY 4ЍOdU  X Lr00r40 r8",/Y0 :<,0@-@QP0M0 A BR* 0*^$"  (R# +N|^3̠ 9^Z^aN@^:^0/Q00S P  0\ Ѝ0(O-PM>N`0p, <0W~XYP  P' 0EP"  RR@P@ @@@fX0P00 0 0Q000Pሐ P ЍO\00) uP =\ R  0 /S0 @/Q0S  P @T @ =0$0 =$003/P V0PC 0P0J (0K  EX@P$P@ @@@ # ZZ P,  ( 0B$00AS*C L0$(0W0 0(0Py(?X?$ Y0P , B$ Z B$ PJ(W0 (0PPZ( X$0PS (T W0 0$ 0 (PE(X0($0X$0 SP 0$ 0@TUZ : 0 0 J( 3/P 0/S0/S W 00/S 0A0CS 0P|U:UPP0\S/SPPSPU @P@ @@@ $>[0 ሐPP00%A00刐00P 00@0$0?o2᧤< Wx VP `  @9003/P @)  0P0] ?$ XP ,0C$0Z 0C$0ZPJ 0P 0J $0PS $0S 0S5  _Wp 0  1  刐 p 00 Ѝ@v?( X0PZ ( C$ AZPJ L0(0Z?$ X0P , B$ B$  \7p003/0PP 0 $0S L0(0 @P PPPm@,@ 0 0A0CSP|U:UPP0 0WP0 SR $[@(0$00 /S  0A0CS0:S|S /R\R00R00S 00J(0$0SRX 4UP 0 00L0(0$0DV 00.S $ R %S ,4@ @( P0$P   nV?o[20S| P@ /RE .RPEp [%RP  2R eRPEpU /RZ .RpPE U%RP  2R eRpPE/Z U(,04@ PZVPH ("VP(OVP) 3003/pP  3003/pH.~0P 0) 00ZPW 00$0SZ(VpP@,04@ PP TPP8 00 0$00C$0 0/SC0 0$00C$0$Q ,04@ P@P (0[ `TP H  2R7  eR2$00S$0 00 0\ ETPR D-(U/ pSPl (AUh.S< $ R  %S R  2R ,4@% @( P0$P U@P2U,04@ PF (,04@ PeUA  eR $  BR8 /P0 00B$0 $  B SP eU  ,SP AjU SP   SP xppzfile|4GD@1B,],?*l*$*)Z(0X(8(dp@-P`@VT0P P d0Er  S QQ0p0pz@-`MP@TUP P 0Lp`Pp @0003/TЍTЍz0 0 , /,L< 0P /- M0   0 Ѝ/p@-b2`0P,03/@Pu P 1003/Pi P 1003/P_ P 1003/PU P `1003/P K P 81003/PA P 1003/P7 P 0003/P- P 0003/P # $P 0003/P$ P p0003/P *0* 0 0*0*0* 0 0*0piR@p贴LO-Xʟ@P MB R% `000: 0P Q0 0S& U0 80&3 `0Jof400 `#P 8Q R B @+Q\S[X$VЍ0X T&3 0 Z400 -#P} Sf`[1P$0S 0000080 0S 0S040*00&7040Q 8UPZ 40S ( 0S 8P ǟ $P S@T9 @0 F *0C 0 0@Sy 0S 0P H 2R iT0 `80 +3N &3R8p R  k 00UT00 =$P5*0  {^ 0 _0[0 W @`T00X0L ph6003/W00<L0X 01S[1 $X0 RJo 00 XP%5003/XS8*00&7080C P mP/8t &30P !?#P S[ 0S U 50<0<H[ P 2H RT0 000000[S c  pX0@0  *00X0l$-<0@ [Q R S 0Q 88D0<W[ d`Q 4PL 4 P 8^@ $@T~ <$ 40 D,@0@0(`QD3@003/00]S00 `80 +3B R0Ppd00KS00 30S/ 0S<0mg40S~ 5SXpt@pQ000 HRP+RplC P[ X"H0P PPN)`(" o Ÿ t`tSL " ]xA@}i00SK 1D0<R000꤁0<DCP |B/P d103 8T&3/P 8!H0 PrPPR `8 P+300S 0 0D00<00  00 D <  ꔲtD !h!zPPԇ;h:(T/H/..|.`.T.H.xL@.88-----4,,O-̟LM `P@ R@1 _R<PP<# 0 Y# 00 Y < pP03/@@LЍP(PP0/SI0   Q Qx `p `@ 0_Q =9Q@/Q-0AS[ PP)QW QT0:0093 8PP dP@@ PPQ: Q PP dP@ @LЍzQ`QA0ASV =Q:! Ar 32 =Qpp~Q V {0A=Q00S pV Q0`0P0@P00S[ pWZ Q PV p8 WBP 8~PP&X  8uPP8qP@P2P l9P003/8P8@LЍp@'WP *0P0(P*0` P0 0IPPyiP @R 0 p%R  @R0 0BaBP QA0BSaA00A SPAAQ74@D aA00A SP@ 80 Q0 P(P00O0 0(@00C S0'8(RQP(0@T#OPP  d7003/80P2 <7pP0p  3/(PpO0 *0P0*0*40(P0 00O P 0( ( O@PP 6(003/P(P0P(P0*0P0(P*0$0P(P 0OpP XNO@] 5003/ *0 0*0P 5003/00G 5$003/ *0$ 0*0; P5 003/ *0 0*0/ 5003/00&@ 4B003/@ 4003/00 4 003/0 0  4003/00 h4003/00j, YN@^Q' ?Q%J3@ Ar 32[00PY 0( NPS(PU P0p#Sp /S /R 0@  Q R{ 0 B8pH N NPP0W @N(P 3003/@ 0 0A0CSWn ŸD*R qd  +0BNs09R<3ZRa0B@R@ @}jN 0S 0[Sm \MWe S8000$08 mP8F  1003/ 0O 0 P0#WPN @$ R}O0 R R ? 0P 0?Sn R2  B/CL P 0 f$ R$ R! # 0fP 0 $pW# 0[S LW0 8p03/ P @O?S ?O  P  $08003/ @ꀧzViphHHOd  @-WBO-0KM`@0 0L=$@LP`K 0 L 0 0@ (Ѝ $pI N0ZPpJ  ` NV@`00Kߍ  4A-@P@KOPP =`@KPx@xpx@p0S 3/P  1`|!P 0S, , !|1`蔤tTDT// 0@- XXp@-@`X PX0P0p@0/ L > ; 0;O-4PR M9 $p@ ) `PU0 E&0 ؠ X;S 0S000S  h0Qz  }0 vPp0 P ЍЍ87Ѝ 7꼗   O-P@$M`sXP  $Ѝ౟ &B6]P?  0uQP E P'E6  X;S 0S h100S  ᧩Y XP V  d P 0QR05  忧 $ЍT  0( PQQ E6  X;S 0S\000S WH aQ QRTQ $ЍP4 $H 1Q0/E /Xˑ\ \/ 00S/@-0 M S0 00%@^   Ѝd00\00T00L00D00<00483Vtd@D@-$M<@(T8P0 \ ` D\  7$Ѝ+$ЍQ V E&  X+R  R t#  Rd0弨0U ~U  p ~@4 Πv ~U,,p "@P @0=0 P0  @ @ 08WP 0S ! ~U EQ\ QZ Vk E h XQ Qbڼ 0学 0Z !lmc\h^4]S@ ~USdB DDD%% p@ u 0;*\2(-#Nd$Jy̒T h(,HO-` M0p4@ uVPQ10 S Z, P `F P  Z    ,0 kVP ?o2QP0S 0 0S4 P$  0 H Ѝ P\t1@-0`0$MS) H L Q0$ 0@00@000pP0P U E&  X+R  R   R*ʈ 0I0$Ѝp 0  |0P U E&  X+R  RP   R@ 0?0$ 070D }S0@-@ @0 MP 0\KH0L 00  Ѝ0+0/0P0Z .0G-P M8@Pb ̀؀<( \4 b0 , X#0SXQ 0 BR`1`!V00UQЍ  K000<0`E6  X;S 0S P000S@ 0 pฦ 0P<0P,O-@p M@ D`P!0 @P40- 8<Pp pWXppR."TpWD0@ Ѝ QQ@ 堠@0@ @ 0,P E&  X+R  RP   R 0'P  OꄉO-,MPP0@0 0T 00,ЍX`0Pp TP 0l$ E  XQ Q Q$R0P00 00 00P 0 000TP 0S H0L 0=TP9 0 S  P0P 000@ 0 0P" E&  X+R  Rڸ!  RT P 0 ݤ0} 00T0 v@00$00 00PE6  X;S 0S 100S"ඤ0T 0P0 T0P  0 TP0    T |ਣ08 P    T   000Oj@`$3\0/@-\MQ> E ; X P P5ڴ00S02 0 P (\&Q" EF  XKT @TDB00S0@,20 ^8 20uŸ  ЍQ E  X P Pڨ00S0 S0 10U{{{h{X10BL@դ,10$101010 1010000000000000000000000000 PFF0td`EsXst\TX p$4  ooO-64M0@`p0SP,0S S= SP 4Ѝ$0(00 ,00 !,( zSPw $Qx Q (0Q (000S$ (0 R$ S S S0~ [8 V8PP0 PU  $00 0, 6(U0X00{ {{${(:/P,sS0, P00PU0 W E  XQ Q ڤ0Qڐ ޣ R ( SP`$ xQP4Ѝ(000;S 00 R " QBq Qm  Rf 1?s0 { #{0 I0P,00{ z{{X00 0 (9/PP0,PP4Ѝ<# +0,0 #P "(000R0$00 P }S0$0(0,00021S} 02/3?@H }S} ( pe LyZ00000$0 l@000000?00H 0S0 P1005 00"00h< }SH3 0$ !(,0~S0(0 S 0(0|xs i 0$P !(P,P0P ,DH<@@@|h,D0<O-2$M@P0p`HP E&  X+R  R!00S4 H6@ 0 H$ЍOPV YP%l0 0 0  @`QP P'PP + $Ѝ0  0 Q P E6  X;S 0Sڜ 垠  i $ЍPPPH Z8 0T yp(T $A-@P`M  8`4`y~q0Pp `Ѝ 0 sD0P P p 'R!0D7/p `P0F P 0 pW  R`+ +`Ѝ7/0`Ѝ, 0E/o0" wG-PM`PPdt@Ppz `&PY0 0Y00 !!$`,P0P4P8PPPE6  X;S 0S#0  @P Q FQ ᾒE6  X;S 0S |300Sl hЍK@P{B6@l=6Sx X0 00Q0  Q ዒE6  X;S 0Sڰ200SB6g" 12003/@Px E6  X;S 0S 0200S0,"`0 AO0  E6 y X+R 0S200S E6 0VRPt  @Pu C@E6 S X;S 0SM T20 Rv0\0 0_E6 0`@PRPE67@ 0PQS@C HqLWDE6 ! X+R 0SBڐ100S<ڠ0H!/E6 00@$@"E6@ 0(` QE6+@ 0E6Q@ 000  BE6+@ 0 )@P 0 ᷱ@ HqL0@00C0H10C0H1E6 0xE67@ 00 00Sotm@P8`0P h Q /- M0QP 0P H6@ P Ѝ(pC-P$2M0`0P] Ÿ ^YH&@PdE&  X+R  R!  R   0|0P< 0@P0S H&@DH L 6 R 0 P0 E  XQ QQ-Ѝp @@ @0J P0Ѝp+ Ѝpi7 Ѝp|al] \WL  4KeD <O-qM00Pp0= LAP IA0s2 CA0`0 0 02/@P% 0U0  0A A0\    0[MЍ  0A 0ЍPcp@-@PA 0p@@Mp@-@P@ 0p@6MA-`PMPp@B4A41@0 <0PP5 3MP4@5O0C 40N000M0 ,0L0(0K0@ $0J0 0I00H00G00F00E0 0D00B00A0??PP @d0 0<0LPЍPЍL<LdB< a @-0S@ \S"S0S\0003/P 0R \\R"R  R ,`A-@,pP@p`0 >U@$A-@,pP@p`0  >U@O-0WMQ(`@ p 0$0a>0ȅS000S 0  R' >@Pt +@ 13/ @\5003/Tf13/ Rb , 0  >@PV @ 13/0@$03/TH@1@3/0  x>@P8 ? 13/0@03/T,13/T4 0!^>0P P" $@P  13/@P1E3/ E/ C>@0 3/T@Wߍ#  ?  13/@0 3/TEO13/0 S 0D00>@T ? 13/0@03/TH`13/0ppP 0Si 0P 0P 0Su 01`00h00 0 0=000 03/ 03/03/X P `Pp  =p03/03/W{  R> =`03/Vm 0E1`?1dE ?w@P] $0 >=@PV 00 ! !0  2/ P 000|=@c 03/9`10 0`k= 03/03/$x^=P03/U `03/^0ftdt| |L|@-@^=^0 ,\  ^=^ =Q"\\ ,\! "\  \ \^ ^   \\^  \ Q ,\0^\ Q0/O-7M0$0T0000` P, ' P0L70 0J@JP T=P 0"SS .( F R 00S"S(0LL 00=P 0S"S .4  R 00"SS4 0L0C0 `b=Pf 0^S,S  IRc 00S,SL L P00E=PI 0"SSY  D@RL 00"SS0L0C0 5P!R.t5T!R*XZ'\e\u\`p P@,=P/,0 a=P(>P>P  >P=00ߍ(0?hc_P?0s?0>(0[0 !  u0P0H4$  8.)`P ,pl=,?t pM) I) 4^=?  A) =)S=? p5)<8) )`P  *) &)(H :=>  ) )/=> )) p `@ 0 :Vp 0 0xT*0P 0 8(`P =>  ( ( p<> (<(0p `D00 :Vp8(`Pg  @( ((p<> ( (0p<> ( (<> (Lp ( ( ( D(<(`0 S:Z`00 P P4 ,0@(0pP;@$`0003/T <0 0| 0Hp0$ 003/00>i`Wauth 0Dmd5-sess @H0@-M$@@\\\=Ѝt h (, Ѝ< 0 (  0OX 0:@P D@9`  q P UލЍN  P 찝0 0徊  젍׊ P 峊 ' 000 0000`vtlv戀Xxp2rrr |$ p$| pq$00000000000000h0d0|` @  X < q\rr$8 0 x T L x$X P "4, 0000 00H0D0@0(0$06P *U   # 3    Y0 8 D2003/00 0 S*0 S0 0S  PE∀  X`@D`    V Z !  0P<N D P+ 0찍x P 0H P0 0 0ⶊ P ,/9@P@PP 0f8  b8 \8  xD 0 3/0 0 0<C (=hDHtPl (@-(0( 00@03/00 0>PRR@-@M@ p6Q  *8L0 0 0cDЍ00 6>0@-P L M6@@P@ 8(0 00=D Ѝ0t=@-M @0@00Ѝ@/=QR0 Q  8b6R $\6 W6/0P R -\ M0D60S# *70 @R#3 Ѝ//; E6 /'R @-@MT~8P 0"Q Ѝ/!7L@o@-0Q0p` M PP@P  Ѝ\PPT0003/ P 800 S P@ Ѝ;thLQ _\Կ0P PR/C- M^ ЍL @A.R p p.R``*P( .R%0P .7@P0  .3T0  .07 P 0 B0D G0FR4PW 4PA-@0@P0Ut`80Pp\}7P : 6P000A0/6PF9X000P/- M06 0 Ѝ4F 0P/E0p@-0@BMTP000 0`6P@U 0Bߍp60 Q  B A o70BߍpE \@ O-PM@`60E/SPpЍ g6 0  @H  0B@Y@ 0 B0BBpF@@DU 04pp  0'7Ѝ /(E-1 @0R*  @Q0QS 1@'0PP.T$ ,զ0 x70, m0l0@9@00P 0^808 0 ".,phG-p 0FM@81$ P`/ W !l,P81V E6  X;S 0S00SFߍ ,20P0 0S> 81Xp00p08!p0 1 !000 CFߍ0QS /0  RXDp0Jw0X? , 60 ى80l0Q 8m0]00S 0X0R0S , 0 ෉x 0  y-, QXr8   j-$,H`LO-p0IM$@p8` 0# 0p9.TP E6  X;S 0S !0 0S00P0安U: [:PT 0 E&  X+R  RX\ xIߍ 00+(!@ 0Q, 0QS /P.P `+U- ,Ⴅ0 %  l QIߍ., c 7Iߍ l P/0X 0,J000 0 ,ȥ|O-`$pAMP M 00 0 00 000l0S p00p0Aލ Ѝl00 @O,0 R Pn.+ s+T` E6  X;S 0S 00S8%0 VPU0C+5`0 P P0 T E6  X;S 0S00Sڠ$ ň0 l0.T E6  X;S 0S00SP8P.($0 ࣈv-P Tp E6 m X;S 0Sg00Scڼ# ]T E6  X;S 0S00Sl# u0 l0H P- +*T0 E&  X+R  R  R" 0S0SCPU 0 *0 60+3-T0 E&  X+R  R~ 0 RD" )#-P0\ *PE6  X;S 0S00S!  0f*0 SP R 0 003/P0p0T0p0 E6  X;S 0S00S$! ߇T E6  X;S 0S00S  ʇT E6  X;S 0S00Sڄ  േ00,P  *P1 +PHأ̣400@-0P@M DQ m 0 ,P0 D0 Smm /3-PЍ ,P $Ѝ@-4MHpx `@  *L0S a+ 0 * 0 {0 *4Ѝ̟QPO-AP@00,M P p1003/,Ѝ0p"!B 0  0)P; 1003/P$4 $)0P - +\ X0SR  \.P   5-`)0\   ??0 0  0 %$PP P  0'P p@-`MP)@P  (P =* 40 yЍpO-8)P$` PU l+`Q )P Q ,P P {)Ul%0 0$`$0k, *[E6  X;S 0SمP00 VY  ,PU E6  X;S 0Sڸ࿅0SBE6 v X;SV\Z +A*P  ,P E6  )E6  X;S 0S X0SYPi+<Ѝ0S0( R 0S d0#300#0f)PU E6 , X;S 0S&XeE6  X;S 0SV c` SE6  X;S 0S0S  BZl)0d0e) M`DP P @PG *P PU  @2003/PPV P x)2 003/(,wX;S 0S[ ))V 1 0 0s+ )MP྄[RP| හ*<ЍPO P1003/@PE 41000 P 0003/4(-#)-QKP00 ) MP y0S_ (P* `000PМl\|lX x4LXLG-pM@D+?o2? Ѝ` $0(p 0P00HXW E6  X;S 0S00S0I*Z QZ2 0 Ѝp0 0p00P0Sp00p0 P 0 00S P  0 4  8 &000O-`eMp@ #B D0  S $ P P  m1%)P D0Sm! m!0D0 R R 4ೃ#0eߍૃ/A0 S   <0SSZ*0 ,0R P: 'P 1S 1!3/0P@1S E6 (d0`.\>0(00D>A0 A$Rr  ,0 ' c0eߍ[F)'0 (-0{ (P $0<0S SS|- St-  0|'P (0$0/*0 )'0)0! ',0QSGQ <0,0CSV!0 x `$ T ,00 X (4 \ 8 ,0 S*0@0eY,0\ $( < )d %< *R HR R0S %0P &P $ ( & 'Yz#00%0Pj  )000Q $v'& '0000S$'0P (P ) & ( & &8'PD &$(P %80S \0U'P 0S b0K'P 00S! P E60 4P X;S 0SL 嗂  )Pn (P 0S [%P1S ,0)'3'3S 0 0P00073#3/70SP &!'P !)%eB0m% 0 S 7%P  LDP000B0d0S0IQ /X(d(`9S /00S0,0(0S$,% ؁0#$&P$e E6  X;S 0S '$)'P$ E6  X;S 0S `؁P'O+R0 h0R $ P<  %&YM Q%h00 (D0@ 'P2 %$DM'P ', x@{%DC%$7 h00(:00 A$I( h%hP h|'PW R0@0@0 #P@0S Q  R" "8 5+00S $0P 0 &`50 ,0 (0'0P $&#?oY20S $ &400&,Q0 $#0 8*P  +P> 00S080 #S' l#0P0( %% '%\% #, $  %0 0000 0($0P0) ['P _&, ᷀ #0Pv &P  &'&G&,d ៀ0*Pf 8(0SS 0 0000$0P "'P &&, ~ #0P 0l&0P, & ^'&, h|,0P00S~P 0 h0H2 0l 0$P X 0 0|h0#P[ lQz $ &P %, 830~l##0.|8, S  R{S x"0P+ $G$ &$$ #< 5$0 $ (0|# 0&Z@ $$PC  # ;06Ĕ 2PHP@jxlP8HДHlЊpT܊$hDT<(̍H؃<(\Ċ`0|܇hx~Xh~l\؄؆,`hĂdv |L~<~$l~~@}~ ~~`P}wE6  X;S 0S$W$P8k~ Lex\ _rpZ%"0$$ 0#0@SD ?$#P *40006$!0w$ $P $,lL0 ^"%0P  l0)"P #0 $Yv ~J ~ ~ #0000S> 80S7 $80 ~<~8,  0 d q"P |RP\80-~~O~ "$ %P  hPPh#@$!P 0 $e#P hM"P@ P@"D_" p4h007%#0 8+P ,P P<P240S  c!0P  R$ (0 "$@#P  ]~*" f#<500,#,X L~ m"tE~500600 S 0, %%c$(0|,0 !P P804~hh#P "E6P 0,S X;S 0Sڧ#,Lt ,~ $@0#,? }}~#,00 }s 0z!P0 0Pc0|,0l000D}WT}Rd}Mt}H}C7080700 C!P P.|8t9#, }"0X $S"P! z"YZ#0j0S 0P000000k", T},", H} 0# Q# -$Q $#P4 ",{l .} (} 3" 0# $J#Yr $!P ",Z  } ! !QE6  X;S 0S4'} @! l|q |jS X;S 0S@0 R7 }d0000 @00S !P 02S0{ P001S 00 @0@0 @0<C Gf?,@4$00\!`h0B@0V 0803@!P E6  X;S 0S <P- z0E6  X;S 0SPZ - |z0F3!! 0 E6  X;S 0S 1z0 0 ! 0 E6  X;S 0Sڤ 1z0 40B0: P0@ `(V VU V , az<@,00+!,7!D0S ,D PE6  X;S 0S0 hzz0(1P 80S=<0@P $$0P+D ( d 0 `  p`, xPȀ!E6  X;S 0SPR 0S0:0   0 0 P z V P $P   $`pdpt,@  0`0A0Pd @ P  0P r 0 P( TE6  X;S 0Sp E6  X;S 0S< y^4 0S,0 S @Pt 0 S PP 0;PE6  X;S 0S40 yB0 0P@D 40B0 80S4 @ 0]y, D40B0 00@ 80<SOo@B8PTTU@@T@00 ߍ0 0P(0K P @PDPP P0SH7F000<7T`0L0 (@p`@.  7 0   0 1 } `0 V 6 0  L 1 c @0 TWH # 0 $& 1 H `0 Vd5 R 0S @e`0 0@T 0 % 1  0` V:d@ `d`x`d0S  `| 0 $ 1 0 XP 0 xxQ Y 0 yl$ 1 0` lVoPR`,PD@Hp s0Z 0  PGU=`V3P@P+  j0 PRg$4# > ;P `p0U  PP4 P/0D`@`0,0Si @V 0SW @V0$,00 00S$T" E6  X;S 0S0(0 w 0 0w`&@P 40 l0P$80S0~0 FX0XPU \\P`P @PpP  0jPP 0v0  4P0cpP /P@+ +TBow mJ@[600& X}$|H}|| |{0Kb}{zzuuttQtss3Tr\rtdm mpFdl lkk0ko jpl mjjLhhg\gff`fxfT]hhdfefegc dgefaYgg0Ye`e`eeb,bceabd(a $a,PD@Hpx) 0 D! 1 c 0 X> 0 ! 1 J `0 Vf+Pe ]P$ tPq Plx x``-  (xP   H 0 h" 1  0@ T% T`  W1 0,0 R `B@0 `0` V 0 (# 1 0@ zT T`E6  X;S 0Sڐ v`0S 0 ]# 1 0@ P?oP  R20ST`=T D @0A`V @P@h4003/Pp   T~ 3003/Zv80S8 u< ,PT`d/uSSuE6  X;S 0SP v P`ppp0 0@P PQ Pu Pi  (0 P6 E6 x X;S9 0S@q  uTj 8%d PFd`x``a`f@`x 6 0,0 @Fd0@  00Wx0  0`0O,0 000 0F70! 0 0 0h0 (   U0B E& + d d Rw R R `   B/o"gX! {r@! trm$0P  d0h I` 0  B/o"JX;S  Q =r0d0d0S? S/_ d d RD Rj RddQ Q QlE6 2 *E& JU|hd8L`ba```p@-@P0 0`03/0P3/0P3/0 P3/0 P3/0P3/0P3/0$P3/0($P3/0,(P3/08,P3/08P3/0 P3/00 P3/040P3/4Pp蘽0p@- (` @RP( 2/P 0(`p0 03/p@-@0(P0`(6/0(PpP/000/ Q  @-p0M0@0 3/0P    0\00Ѝ/p@-PA0B A0B0 00< B0B0< B 0 0B0B0B 0 0B0B0B 0 0B0@0@@0$$bP` p((P,,PPy @2003/P Pq 2003/P Pi 1003/P Pa 1003/P PY 1003/P PQ x1003/P P; P1003/P 8P? (1003/P8 P7 1003/P P/ 0003/P 0P' 0003/P0 40S 003/0P40p 8 040pк|!|1 0\l1O-0 M R6 @L @R+ `0P @Ȑ03/P UI5 00X-     P0@T`   E00 Q 00 R0#0%:Ѝh00ȀЍH  <004pYt\TH4 X;H;C-`P0M` `0S 0Ѝ0000S 0 `(0p( 0@6/W0 E&  X+R  R  R  @  0p 0S (   W R /04Q 0S@-@M-P 0"Ѝ0hS 2R hS03S0S  0" R 0"L p@-@P p<04P03/08400$3/0p@/ဴ0A-@P0 00@PpP0S+ `P0 S P0@S ZP t t0 A003/L000D0,0003/$оVl@0d d0 0Q /- M P 00S Ѝ/ ЍpA-|0|0@ M T P Ѝ@p`0P0 P T0ЍA/dA-|0|0@ M T P Ѝ@p`0bP0 P P0ЍA/м`` `0 0\/0@-@ MP DP 080 Ѝ0@/ Ѝ0Dԫl l0 0\ /0@-@ MP &P 040 Ѝ0@/ Ѝ0ԻdA-T@T0@0\ Pp`P0 A00/TA-T@T0@0\ Pp`P0 A,0/|A-T@T0@0\ Pp`P0 A$0/ᄺt@`Z N f`PL dPC 0P0 0P S=04  0P4  0CR* @P`fP@ U  R R  P U@P:P * II `V 0 S P  P 0EXqDCC(CAA000(P//ᐨ@000S/00@-000S 3/ 00 贪X|RA-p` 0000@0@ 0R 0S" V" o0SP@ V P0PS RD D0 0Q ! \p@-h0h 0`@03/ S  03/P0P3/0 P3/ PPp4p@-PM0(`80(@3/0`000P0 003/0(`ЍpA-`@P0(p80(3/``000(p`A-p M 0  0 R T PaX02R`@0Q 0SN 100 3/P0G Q ~P0 03/P9 0S00 R20 0  P6 0B0.S0Q 0 003/P 0   0PPЍPEЍP 0 P0 0  P0 0꼚LC-0plM `0S 000lЍ\0 0`P@@ 0( U(P E6  X;S 0S00Sk000S3 p0@ 0 ,03/0P 0S 000`0SK 0U E&  X+R  R  RH (lЍ0 03/0P0S 00 O0 3/0 0P 3S5# "S*p0 0p00,03/0P R    ` R ? d  Sh  D  0Jh 0,g#0\gh99x9$9A-P@Mh`0\ 0 80Pp000S ЍS+80h0-\"Dh0SB S00 0 S \  r0EV E6  X;S 0Sg0\0X 8S 10 ,Vp8 E6  X; S 0S 00S0   gW 00 0 S 0\ EV E6  X;S 0S\ g877C-M4@`(p^`P(& \0S S,*4 0PE0\0 T@0 4/P40 004 00(pЍU0(pЍ ;P 0SQ0C\040PC-0M@0 (p(0` PR` 000P@ 0 4/0(pЍ  0P0SQ@- MP`pW0P@  Ѝ 0: Ѝ@-@M  C0P Ѝ 0:0Ѝ00@-PGM 0 h P X H G:0P@  !Ѝ0 o:Ѝ0@U 0000/ᬛO-PMU 80qW (ß@ @Tz 0 SE6 ` X;S 0S 200S" f0 H00d000(0(` ` 0pX IPQpV0  09/PX0S l R  0 9=PXj 0S S0 `p( (0 00>I0SPPP0 9E6  X;S 0S 00SL!0 `fЍPЍ0 00I00I pf  `IPP `0 p( 000H|   pe0  0( 0 `H8PD pe0 `P( P`043t2(210 @o/00 0 S;/0 0 0 SWF/G-(  Y pW p` S@  0`Sp Q @ T0 p$pG-p(  W @T" @,` ST@@u 0`SQP 0 R0@$ppG-Q @j TP` pW PPU @ Y V  P @-@MD PЍ * 0 0Ѝ0Q @- 0 @ Q@ 00$ A A-`4@|"MTp P 0) Si  0P  PU E6  X;S 0S eЍ  0pd#ЍWS+  b @P_1 003/P4  40 @`0S: U E6  X;S 0S$0 d`0S Q E6  X;S 0Sd dQ E6  X;S 0SڄdU E6  X;S 0SH0 d0fd</...-H.-T-p@-P<0< 0@03/03/03/0p@/ᐇp@-@o `P` $0S 3/0 0P\0$P`03/0P3/0 P3/0 P3/p0P0lPp0p,R \ p@-/\`P@M  0P  d 0 0 Ѝp /000 Ѝp@,,0S/p@-@ |(MPP (Ѝp00cP@`@`(0T P@ h,L0S R P0Q /D0S R /@-c Q+0 S p000p0/Q 0SQ -M 0 P  QGP p000p0Ѝ0Q:Co0Q  @- M@0|PЍ00|P0 4|oЍR /0S o/O-4P `p0  ABaЍMbM l A 0R??@a" R "! 01>Ѝ/Mb-M  P2P=0Ġ4;0  P, 0 PЍ0 -Q0 MD0 P p PЍ/00p//////p////p// Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/PzQ @-@A/Q0  aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/P;Q @-@A/!1#0@-@P40y JZtPe@ 0!"# 0!6U0Ơ! p6#6 r04W @D uΠ2S PE RΠ#SQZ|Q:Q:`l@*rU*\0@TQ#*1?o 0 0C S  b 1 b0@T0@@T @@ d010 @d d001046#!@PE 40 010ʰ#0E208Q00 FV100/0@-K2@P0/0@-K2@Q`B a43!/$/3/0@-MQ /0@-P /0@-QZpK2@!˰Z    ! 0bà01@MSRQP8M`-QSsЍ /pSjЍ p r0/ r0_Ѝ p/ r0VЍ r0/SRQPM`-EЍ /@-%0P0 c0?o 0c/P0 @H 0A0 0!!( #2 0 /UUUU3333 A{J@-!p A {{&{[GKEk{ / =AC-P3`16:SOoOo @^oo @D pD47 Pd25$\31:\0T  /0\:\ X <ĠŌ>nj>47D<5PVP @->A AA'A6AAAAAA&AA)AAA A Ah1h2h3[# Your alt-svc cache. https://curl.se/docs/alt-svc.html # This file was generated by libcurl! Edit at your own risk. %s %s%s%s %u %s %s%s%s %u "%d%02d%02d %02d:%02d:%02d" %u %u ; clearmapersistBad alt-svc hostname, ignoring.Bad alt-svc IPv6 hostname, ignoring.Unknown alt-svc port number, ignoring.Added alt-svc: %.*s:%d over %scancelling resolve threadasync_thrdd_destroy, thread joinedasync_thrdd_destroy, thread detachednot threaded: is_resolved(), already done, dns=%sfoundis_resolved() result=%d, dns=%sfoundresolve, wait for thread to finishinit threaded resolve of %s:%dstarting new resolve, with previous not cleaned upresolve thread started for of %s:%dresolve thread failed init: %dgetaddrinfo() thread failed to startnew tunnel state 'init'new tunnel state 'connect'new tunnel state 'receive'new tunnel state 'response'new tunnel state 'established'CONNECT phase completednew tunnel state 'failed'close%s cannot be done over CONNECTallocate connect bufferProxy CONNECT aborted due to timeoutCONNECT startEstablish HTTP proxy tunnel to %sFailed sending CONNECT to proxyCONNECT sendCONNECT receiveProxy CONNECT connection closedProxy CONNECT abortedchunk reading DONECONNECT response too largeIgnore %lld bytes of response-bodyIgnore chunked response-bodyCONNECT: no content-length or chunkedWWW-Authenticate:Proxy-authenticate:CONNECT: fwd auth header '%s'Content-Length:Ignoring Content-Length in CONNECT %03d responseUnsupported Content-Length valueConnection:Transfer-Encoding:Ignoring Transfer-Encoding in CONNECT %03d responseCONNECT responded chunkedProxy-Connection:HTTP/1.CONNECT responseCONNECT need to close+openConnect me again pleaseCONNECT tunnel failed, response %dCONNECT tunnel established, response %ddestroyH1-PROXYTCP6TCP4PROXY UNKNOWN PROXY %s %s %s %i %i HAPROXYshutdown -> %d, done=%dadjust_pollset -> %d, %d socksconnect+handshake %s: %dms, 1st data: %dmsdeferred handshake %s: %dmsconnect, initset next attempt to start in %lldmsall previous attempts failed, starting %shard timeout of %lldms reached, starting %ssoft timeout of %lldms reached, %s has not seen any data, starting %sconnect, check %sconnect, all attempts failedconnect -> %d, done=%dadding wanted h3adding wanted h2adding wanted h1HTTPS-CONNECTquery connect reply: %dmsnextfirstvia Connection time-outinit ip ballers for transport %dconnect attempt #%d successfulchecked connect attempts: %d ongoing, %d inconclusivehappy eyeballs timeout expired, start next attemptstarting %s attempt for ipv%s -> %dtried all addresses with inconclusive results, restarting onerestarted baller %d -> %dno more attempts to tryballer %d: result=%dConnection timeout after %lld msFailed to connect to %s port %u %s%s%safter %lld ms: %sConnected to %s (%s) port %uunsupported transport type %dHAPPY-EYEBALLSis_alive: poll error, assume deadis_alive: poll timeout, assume aliveis_alive: err/hup/etc events, assume deadis_alive: valid events, looks aliverecv(len=%zu) -> %d, %zuRecv failure: %sSend failure: %ssend(len=%zu) -> %d, %zuadjust_pollset, listening, POLLIN fd=%dadjust_pollset, !connected, POLLOUT fd=%dadjust_pollset, !active, POLLIN fd=%dcf_socket_shutdown, fd=%dCould not set TCP_NODELAY: %ssocket successfully bound to interface '%s'Couldn't bind to interface '%s' with errno %d: %sLocal Interface %s is ip %s using address family %iName '%s' family %i resolved to '%s' family %iCouldn't bind to '%s' with errno %d: %sLocal port: %huBind to local port %d failed, trying nextbind failed with errno %d: %scf_socket_close, fd=%dImmediate connect fail for %s: %sgetsockname() failed with errno %d: %sssloc inet_ntop() failed with errno %d: %sAccept timeout occurred while waiting server connectChecking for incoming on fd=%d ip=%s:%dsocket_check -> %xError while waiting for server connectReady to accept data connection from serverError accept()ing server connectnothing heard from the server yetConnection accepted from servergetpeername() failed with errno %d: %sssrem inet_ntop() failed with errno %d: %saccepted_set(sock=%d, remote=%s port=%d)curl_sa_addr inet_ntop() failed with errno %d: %s Trying [%s]:%d... Trying %s:%d...Failed to set SO_KEEPALIVE on fd %d: errno %dFailed to set TCP_KEEPIDLE on fd %d: errno %dFailed to set TCP_KEEPINTVL on fd %d: errno %dFailed to set TCP_KEEPCNT on fd %d: errno %dcf_socket_open() -> %d, fd=%dQUICUDPcf_udp_connect(), open failed -> %d%s socket %d connected: [%s:%d] -> [%s:%d]cf_udp_connect(), opened socket=%d (%s:%d)cf_udp_connect(), opened socket=%d (unconnected)Failed to enable TCP Fast Open on fd %dlocal address %s port %d...not connected yetconnect to %s port %u from %s port %d failed: %sset filter for listen socket fd=%d ip=%s:%dTCP-ACCEPTUNIXTCP secondaryshutdown start on%s connectionshut down failed with %dshut down not done yetshut down successfullyrecv: no filter connectedsend: no filter connectedadded2nd Curl_conn_connect(block=%d) -> %d, done=%dEstablished %sconnection to %s (%s port %u) from %s port %u Curl_conn_connect(), filter returned %dconnect timeoutCurl_conn_connect(block=1), do pollCurl_conn_connect(block=1), Curl_poll() -> %dquery ALPN[CPOOL] not discarding #%lld still in use by %u transfers[SHARE] %s[CPOOL] destroy, %zu connections[CPOOL] added connection %lld. The cache now contains %zu membersclosingshutting down%s connection #%lldclosing connection #%lldDiscarding connection #%lld from %zu to reach destination limit of %zuDiscarding connection #%lld from %zu to reach total limit of %zuConnection pool is full, closing the oldest of %zu/%uhaproxy protocol not support with SSL encryption in place (QUIC?)http/1.1SETUP1.3.1Error while processing content unencoding: %sError while processing content unencoding: Unknown failure within decompression software.identityUnrecognized content encoding type. libcurl understands %s content encodings.transfercontentlooking for %s decoder: %.*sdecoder not requested, ignored: %.*sA Transfer-Encoding (%.*s) was listed after chunkedUnsolicited Transfer-Encoding (%.*s) foundReject response due to more than %u content encodingsignoring duplicate 'chunked' decoderReject response due to 'chunked' not being the last Transfer-Encodingadded %s decoder %s -> %dce-errornonegzipx-gzipdeflate#HttpOnly_FALSEunknownTRUE%s%s%s %s %s %s %lld %s %sReplacedAdded; =; cookie contains TAB, droppingoversized cookie dropped, name/val %zu + %zu bytes__Secure-__Host-invalid octets in name/value, cookie droppedsecurehttponlydomainlocalhostskipped cookie with bad tailmatch domain: %sversionmax-ageexpires cookie '%s' for domain '%s' dropped, would overlay an existing cookie%s cookie %s="%s" for domain %s, path %s, expire %lldrbWARNING: failed to open cookie file "%s"Set-Cookie:ignoring failed cookie_init for %s127.0.0.1::1Included max number of cookies (%zu) in request!# Netscape HTTP Cookie File # https://curl.se/docs/http-cookies.html # This file was generated by libcurl! Edit at your own risk. %s WARNING: failed to save cookies in %s: %s[SHUTDOWN] shutdown, done=%dforce [SHUTDOWN] %sclosing connection #%lld[SHUTDOWN] trigger multi connchanged[SHUTDOWN] perform on %zu connections[SHUTDOWN] discarding oldest shutdown connection due to connection limit of %zu[SHUTDOWN] update events failed, discarding #%lld[SHUTDOWN] added #%lld to shutdowns, now %zu conns in shutdown[SHUTDOWN] destroy, %zu connections, timeout=%dms[SHUTDOWN] shutdown all[SHUTDOWN] shutdown finished cleanlybest effort done[SHUTDOWN] shutdown finished, %s[SHUTDOWN] shutdown finished, abortedLOGINSASL: %s not builtinSASL: %s not supported by the platform/librariesSASL: %s is missing %sSASL: %s is missing username*EXTERNALDIGEST-MD5CRAM-MD5NTLMOAUTHBEARERXOAUTH2PLAINUnsupported SASL authentication mechanismCURLOPT_XOAUTH2_BEARERSASL: no auth mechanism was offered or recognizedSASL: no overlap between offered and configured auth mechanismsSASL: no auth mechanism offered could be selectedSASL: auth EXTERNAL not chosen with passwordGSSAPISCRAM-SHA-1SCRAM-SHA-256[%lld-%lld] [%lld-x] [x-%lld] [x-x] [%s] [%s-%d] UNKNOWN?[TIMEOUT] %s expires in %lldnsnetworkdohdnsWSSSLSSMTPFTPINITPENDINGCONNECTRESOLVINGCONNECTINGTUNNELINGPROTOCONNECTPROTOCONNECTINGDODOINGDOING_MOREDIDPERFORMINGRATELIMITINGCOMPLETEDMSGSENT100_TIMEOUTASYNC_NAMECONNECTTIMEOUTDNS_PER_NAMEDNS_PER_NAME2HAPPY_EYEBALLS_DNSHAPPY_EYEBALLSMULTI_PENDINGSPEEDCHECKTOOFASTFTP_ACCEPTALPN_EYEBALLSSHUTDOWNDNSWRITEREADMULTILIB-IDS[OUT] wrote %zu %s bytes -> %zuWrite callback asked for PAUSE when not supported[OUT] PAUSE requested by clientclient returned ERROR on write of %zu bytesFailure writing output to destination, passed %zu returned %zd[OUT] paused, buffering %zu more bytes (%zu/%d)pause buffer not large enough -> CURLE_TOO_LARGE[OUT] unpause[OUT] donecw-out[PAUSE] flushed %zu/%zu bytes, type=%x -> %d[PAUSE] flushed 0/%zu bytes, type=%x -> %d[PAUSE] writing %zu/%zu bytes of type %x -> %d[PAUSE] buffer %zu more bytes of type %x, total=%zu -> %dcw-pause\default/MATCH:/M:/FIND:lookup word is missingCLIENT libcurl 8.16.0 MATCH %s %s %s QUIT Failed sending DICT request/DEFINE:/D:/LOOKUP:CLIENT libcurl 8.16.0 DEFINE %s %s QUIT CLIENT libcurl 8.16.0 %s QUIT dictezm:doh-punknown sub request donea DoH request is completed, %u to goDoH request %sFailed to encode DoH packet [%d]Content-Type: application/dns-messagehttpsAAAACould not DoH-resolve: %sDoH: %s type %s for %shostname: %s[DoH] TTL: %u seconds[DoH] A: %u.%u.%u.%u%s%02x%02xCNAME: %s[DoH] AAAA: Bad labelOut of rangeLabel loopToo smallOut of memoryRDATA lengthMalformatBad RCODEUnexpected TYPEUnexpected CLASSNo contentBad IDName too long%.*s: %.*s easy handle already used in multi handleCONNECT_ONLY is requiredFailed to get recent socketABSTRACT_UNIX_SOCKETACCEPTTIMEOUT_MSACCEPT_ENCODINGADDRESS_SCOPEALTSVCALTSVC_CTRLAPPENDAUTOREFERERAWS_SIGV4BUFFERSIZECAINFOCAINFO_BLOBCAPATHCA_CACHE_TIMEOUTCERTINFOCHUNK_BGN_FUNCTIONCHUNK_DATACHUNK_END_FUNCTIONCLOSESOCKETDATACLOSESOCKETFUNCTIONCONNECTTIMEOUT_MSCONNECT_ONLYCONNECT_TOCONV_FROM_NETWORK_FUNCTIONCONV_FROM_UTF8_FUNCTIONCONV_TO_NETWORK_FUNCTIONCOOKIECOOKIEFILECOOKIEJARCOOKIELISTCOOKIESESSIONCOPYPOSTFIELDSCRLFCRLFILECURLUCUSTOMREQUESTDEBUGDATADEBUGFUNCTIONDEFAULT_PROTOCOLDIRLISTONLYDISALLOW_USERNAME_IN_URLDNS_CACHE_TIMEOUTDNS_INTERFACEDNS_LOCAL_IP4DNS_LOCAL_IP6DNS_SERVERSDNS_SHUFFLE_ADDRESSESDNS_USE_GLOBAL_CACHEDOH_SSL_VERIFYHOSTDOH_SSL_VERIFYPEERDOH_SSL_VERIFYSTATUSDOH_URLECHEGDSOCKETENCODINGERRORBUFFEREXPECT_100_TIMEOUT_MSFAILONERRORFILEFILETIMEFNMATCH_DATAFNMATCH_FUNCTIONFOLLOWLOCATIONFORBID_REUSEFRESH_CONNECTFTPAPPENDFTPLISTONLYFTPPORTFTPSSLAUTHFTP_ACCOUNTFTP_ALTERNATIVE_TO_USERFTP_CREATE_MISSING_DIRSFTP_FILEMETHODFTP_RESPONSE_TIMEOUTFTP_SKIP_PASV_IPFTP_SSLFTP_SSL_CCCFTP_USE_EPRTFTP_USE_EPSVFTP_USE_PRETGSSAPI_DELEGATIONHAPPY_EYEBALLS_TIMEOUT_MSHAPROXYPROTOCOLHAPROXY_CLIENT_IPHEADERDATAHEADERFUNCTIONHEADEROPTHSTSHSTSREADDATAHSTSREADFUNCTIONHSTSWRITEDATAHSTSWRITEFUNCTIONHSTS_CTRLHTTP09_ALLOWEDHTTP200ALIASESHTTPAUTHHTTPGETHTTPHEADERHTTPPOSTHTTPPROXYTUNNELHTTP_CONTENT_DECODINGHTTP_TRANSFER_DECODINGHTTP_VERSIONIGNORE_CONTENT_LENGTHINFILEINFILESIZEINFILESIZE_LARGEINTERLEAVEDATAINTERLEAVEFUNCTIONIOCTLDATAIOCTLFUNCTIONIPRESOLVEISSUERCERTISSUERCERT_BLOBKEEP_SENDING_ON_ERRORKEYPASSWDKRB4LEVELKRBLEVELLOCALPORTLOCALPORTRANGELOGIN_OPTIONSLOW_SPEED_LIMITLOW_SPEED_TIMEMAIL_AUTHMAIL_FROMMAIL_RCPTMAIL_RCPT_ALLLOWFAILSMAIL_RCPT_ALLOWFAILSMAXAGE_CONNMAXCONNECTSMAXFILESIZEMAXFILESIZE_LARGEMAXLIFETIME_CONNMAXREDIRSMAX_RECV_SPEED_LARGEMAX_SEND_SPEED_LARGEMIMEPOSTMIME_OPTIONSNETRCNETRC_FILENEW_DIRECTORY_PERMSNEW_FILE_PERMSNOBODYNOPROGRESSNOPROXYNOSIGNALOPENSOCKETDATAOPENSOCKETFUNCTIONPATH_AS_ISPINNEDPUBLICKEYPIPEWAITPORTPOST301POSTFIELDSIZEPOSTFIELDSIZE_LARGEPOSTQUOTEPOSTREDIRPREQUOTEPREREQDATAPREREQFUNCTIONPRE_PROXYPRIVATEPROGRESSDATAPROGRESSFUNCTIONPROTOCOLSPROTOCOLS_STRPROXYAUTHPROXYHEADERPROXYPASSWORDPROXYPORTPROXYTYPEPROXYUSERNAMEPROXYUSERPWDPROXY_CAINFOPROXY_CAINFO_BLOBPROXY_CAPATHPROXY_CRLFILEPROXY_ISSUERCERTPROXY_ISSUERCERT_BLOBPROXY_KEYPASSWDPROXY_PINNEDPUBLICKEYPROXY_SERVICE_NAMEPROXY_SSLCERTPROXY_SSLCERTTYPEPROXY_SSLCERT_BLOBPROXY_SSLKEYPROXY_SSLKEYTYPEPROXY_SSLKEY_BLOBPROXY_SSLVERSIONPROXY_SSL_CIPHER_LISTPROXY_SSL_OPTIONSPROXY_SSL_VERIFYHOSTPROXY_SSL_VERIFYPEERPROXY_TLS13_CIPHERSPROXY_TLSAUTH_PASSWORDPROXY_TLSAUTH_TYPEPROXY_TLSAUTH_USERNAMEPROXY_TRANSFER_MODEPUTQUICK_EXITRANDOM_FILERANGEREDIR_PROTOCOLSREDIR_PROTOCOLS_STRREQUEST_TARGETRESOLVERESOLVER_START_DATARESOLVER_START_FUNCTIONRESUME_FROMRESUME_FROM_LARGERTSPHEADERRTSP_CLIENT_CSEQRTSP_REQUESTRTSP_SERVER_CSEQRTSP_SESSION_IDRTSP_STREAM_URIRTSP_TRANSPORTSASL_AUTHZIDSASL_IRSEEKDATASEEKFUNCTIONSERVER_RESPONSE_TIMEOUTSERVER_RESPONSE_TIMEOUT_MSSERVICE_NAMESHARESOCKOPTDATASOCKOPTFUNCTIONSOCKS5_AUTHSOCKS5_GSSAPI_NECSOCKS5_GSSAPI_SERVICESSH_AUTH_TYPESSSH_COMPRESSIONSSH_HOSTKEYDATASSH_HOSTKEYFUNCTIONSSH_HOST_PUBLIC_KEY_MD5SSH_HOST_PUBLIC_KEY_SHA256SSH_KEYDATASSH_KEYFUNCTIONSSH_KNOWNHOSTSSSH_PRIVATE_KEYFILESSH_PUBLIC_KEYFILESSLCERTSSLCERTPASSWDSSLCERTTYPESSLENGINESSLENGINE_DEFAULTSSLKEYSSLKEYPASSWDSSLKEYTYPESSLKEY_BLOBSSL_CIPHER_LISTSSL_CTX_DATASSL_CTX_FUNCTIONSSL_EC_CURVESSSL_ENABLE_ALPNSSL_ENABLE_NPNSSL_FALSESTARTSSL_OPTIONSSSL_SESSIONID_CACHESSL_SIGNATURE_ALGORITHMSSTDERRSTREAM_DEPENDSSTREAM_DEPENDS_ESTREAM_WEIGHTSUPPRESS_CONNECT_HEADERSTCP_FASTOPENTCP_KEEPALIVETCP_KEEPCNTTCP_KEEPIDLETCP_KEEPINTVLTCP_NODELAYTELNETOPTIONSTFTP_BLKSIZETFTP_NO_OPTIONSTIMECONDITIONTIMEVALUE_LARGETLS13_CIPHERSTLSAUTH_PASSWORDTLSAUTH_TYPETLSAUTH_USERNAMETRAILERDATATRAILERFUNCTIONTRANSFERTEXTTRANSFER_ENCODINGUNIX_SOCKET_PATHUNRESTRICTED_AUTHUPKEEP_INTERVAL_MSUPLOADUPLOAD_BUFFERSIZEUPLOAD_FLAGSUSERAGENTUSERPWDUSE_SSLVERBOSEWILDCARDMATCHWRITEHEADERWS_OPTIONSXFERINFODATAXFERINFOFUNCTIONmeta:proto:file:easycannot open %s for writingcannot get the size of %sContent-Length: %lld Last-Modified: %s, %02d %s %4d %02d:%02d:%02d GMT cannot get the size of file.failed to resume file:// transferCouldn't open file %s%s%s.tmpapplication/octet-streammultipart/form-data[%s] -> [%s]meta:proto:ftp:conn[%s] ftp_domore_pollset()meta:proto:ftp:easy[%s] DO phase failed[%s] DO phase is complete2[%s] closing DATA connection???[%s] ftp_state_retr()Maximum file size exceededftp server does not support SIZEOffset (%lld) was beyond file size (%lld)File already completely downloadedInstructs server to resume from offset %lldREST %lldRETR %sConnect data stream passivelyFailed EPSV attempt, exitingFailed EPSV attempt. Disabling EPSVPASVAPPE %sSTOR %sSIZE %sCould not seek streamFailed to read dataFile already completely uploadedNLSTLIST%s%s%.*sgetsockname() failed: %sfailed to resolve the address provided to PORT: %s[%s] ftp_state_use_port(), opened socketbind() failed, we ran out of portsbind(port=%hu) on non-local address failed: %sbind(port=%hu) failed: %s[%s] ftp_state_use_port(), socket bound to port %dsocket failure: %s[%s] ftp_state_use_port(), listening on %d%s |%d|%s|%hu|Failure sending EPRT command: %s,%d,%dFailure sending PORT command: %sftp_initiate_transfer()path contains control charactersUploading to a URL without a filenameRequest has same path as previous transfer;type=[%s] setup connection -> %dIllegal port number in EPSV replyWeirdly formatted EPSV replyCouldn't interpret the 227-responseSkip %u.%u.%u.%u for data connection, reuse %s instead%u.%u.%u.%uBad PASV/EPSV response: %03dcannot resolve proxy host %s:%hucannot resolve new host %s:%huConnecting to %s (%s) port %dsending QUIT to close sessionQUITFailure sending QUIT command: %sin shutdown, waiting for server responseREST %dCouldn't set desired modeGot a %03d response code instead of the assumed 200TYPE %cMDTM %sCWD %sCWD %.*sPRET %sPRET STOR %sPRET RETR %sPBSZ %dgetFTPResponse startFTP response timeoutFTP response aborted due to select/poll error: %dWe got a 421 - timeoutgetFTPResponse -> result=%d, nread=%zd, ftpcode=%dThere is negative response in cache while serv connectCtrl conn has data while waiting for data connGot 226 before data activityFTP code: %03d[%s] DO-MORE phase ends with %dWildcard - Parsing startedWildcard - START of "%s"Wildcard - "%s" skipped by user[%s] DO phase starts[FTP] [%s] perform, DATA connection established[%s] perform, awaiting DATA connect[%s] DO phase is complete1Got a %03d ftp-server response when 220 was expectedunsupported parameter to CURLOPT_FTPSSLAUTH: %dAUTH %sUSER %sPASS %sACCT %sACCT requested but none availableAccess denied: %03dACCT rejected by server: %03dPROT %cFailed to clear the command channel (CCC)SYSTEntry path is '%s'Failed to figure out path[%s] protocol connect phase DONEOS/400SITE NAMEFMT 1QUOT command failed with %03dMKD %.*sServer denied you to change to the given directoryFailed to MKD dir: %03d%04d%02d%02d %02d:%02d:%02d GMTunsupported MDTM reply formatMDTM failed: file does not exist or permission problem, continuingThe requested document is not new enoughThe requested document is not old enoughSkipping time comparisonThe file does not existCouldn't use RESTPRET command not accepted: %03ddisabling EPRT usageFailed to do PORTConnect data stream activelyMaxdownload = %lldGetting file with size: %lldData conn was not available immediatelyRETR response: %03dFailed FTP upload: %0dRemembering we are in dir "%s"ABORFailure sending ABOR command: %scontrol connection looks deadpartial download completed, closing connectionExceeded storage allocationserver did not report OK, got %dUploaded unaligned file size (%lld out of %lld bytes)Received only partial file: %lld bytesNo data was receivedQUOT string not accepted: %s[%s] done, result=%dTLSftp-lineconvftpsftpSTOPWAIT220USERPASSACCTPBSZPROTNAMEFMTRETR_PREQUOTESTOR_PREQUOTELIST_PREQUOTECWDMKDMDTMLIST_TYPERETR_LIST_TYPERETR_TYPESTOR_TYPERETR_SIZESTOR_SIZERESTRETR_RESTRETRSTOR -> total rwx-tTsS0123456789-APM0123456789:

HEAD/etc/ssl/certs/ca-certificates.crt%s?%sFailed sending Gopher requestgophersgopherToo many response headers, %d is maxInvalid response headerheader_collect pushed(type=%x, len=%zu) -> %dhds-collect(none)Host %s:%d was resolved., too many IP, cannot showIPv6: %sIPv4: %s:%uHostname in DNS cache was stale, zappedHostname in DNS cache does not have needed family, zappedShuffling %i addressesStore negative name resolve for %s:%d (non-permanent)Resolve address '%s' found illegalCouldn't parse CURLOPT_RESOLVE entry '%s'RESOLVE %.*s:%lld - old addresses discardedAdded %.*s:%lld:%s to DNS cache%sRESOLVE *:%lld using wildcard (Could not resolve %s: %s%s%s%sHostname '%s' was found in DNS cache.onion.onion.Not resolving .onion address (RFC 7686)Hostname %s was found in DNS cachelocalhost..localhost.localhost.Negative DNS entryincludesubdomainsunlimited# Your HSTS cache. https://curl.se/docs/hsts.html # This file was generated by libcurl! Edit at your own risk. %s%s "%d%02d%02d %02d:%02d:%02d" %s%s "%s" %d%02d%02d %02d:%02d:%02dSwitch to GET because of %d responseStick to %s instead of GETThe redirect target URL could not be parsed: %sClear auth, redirects to port from %u to %uClear auth, redirects scheme from %s to %sMaximum (%d) redirects followedIssue another request to this URL: '%s'Drop custom request method for next requestEmpty reply from serverDone waiting for 100-continue send, Need to rewind upload for next request%s%sclose instead of sending %lld more bytes%s%sclose instead of sending unknown amount of more bytesHTTP/Proxy-DigestBasicBearerProxyServerProxy-authorizationAuthorization%s:%s%sAuthorization: Basic %s Authorization: Bearer %s %s auth using %s with user '%s';:Forcing HTTP/1.1 for NTLMThe requested URL returned error: %dNTLM authentication problem, ignoring.Ignoring duplicate digest auth header.Digest authentication problem, ignoring.Basic authentication problem, ignoring.Bearer authentication problem, ignoring.HostContent-TypeConnectionContent-LengthCookie%.*s: If-Modified-SinceIf-Unmodified-SinceLast-ModifiedInvalid TIMEVALUE%s: %s, %02d %s %4d %02d:%02d:%02d GMT HTTP/1.xHTTP/3HTTP/2; Connection: using %sHost:Host:%s Host: %s%s%s Host: %s%s%s:%d User-AgentContent-RangeUnable to resume from offset %lldRange: bytes=%s Content-Range: bytes 0-%lld/%lld Content-Range: bytes %s%lld/%lld Content-Range: bytes %s/%lld %s http;type=%c?%s HTTP/%s AcceptAccept: */* TETE: gzip Accept-EncodingAccept-Encoding: %s RefererReferer: %s Proxy-ConnectionProxy-Connection: Keep-Alive suppressing chunked transfer encoding on connection using HTTP version 2 or higherChunky upload is not supported by HTTP 1.0Transfer-Encoding: chunked Alt-UsedAlt-Used: %s:%d Cookie: Restricted outgoing cookies due to header size, '%s' not sent%s%s=%sContent-Type: application/x-www-form-urlencoded Expect100-continueExpect:Expect: 100-continue Connection: %sUpgradeHTTP2-SettingsHTTP request too largeToo large response headers: %zu > %uLying server, not serving HTTP/2Unsupported response code in HTTP responseunexpected 101 response codeReceived 101, Switching to HTTP/2no chunk, no close, no size. Assume close to signal endConnection closure while negotiating auth (HTTP 1.0?)Refused WebSockets upgrade: %dGot HTTP failure 417 while waiting for a 100Got HTTP failure 417 while sending dataHTTP error before end of send, keep sendingHTTP error before end of send, stop sendingKeep sending data to get tossed awayIgnoring the response-bodyThe entire document is already downloadedHTTP server does not seem to support byte ranges. Cannot resume.Simulate an HTTP 304 responsesetting size while ignoringUnsupported HTTP/1 subversion in responseUnsupported HTTP version in responseRTSP/1.0Version mismatch (from HTTP/%u to HTTP/%u)HTTP 1.0, assume close after bodyNul byte in headerHeader without colonAlt-Svc:Overflow Content-Length: valueInvalid Content-Length: valueContent-Encoding:Content-Type:keep-aliveHTTP/1.0 connection set to keep aliveContent-Range:Last-Modified:Location:HTTP/1.0 proxy connection set to keep aliveHTTP/1.1 proxy connection set closeRetry-After:Strict-Transport-Security:Illegal STS header skippedTrailer:Unsupported HTTP version (%u.%d) in responseRTSP/Invalid status lineReceived HTTP/0.9 when not allowed@:schemeset pseudo header %s to %s:method:authority:path ;,trailerscr-exp100Keep-Alive://%s %s%s%s%s HTTP/1.%d %20%%%02X%s=%s%s=&Cannot use sigv4 authentication with path-as-is flagaws:amzfirst aws-sigv4 provider cannot be emptyaws-sigv4: service missing in parameters and hostnameaws_sigv4: picked service %.*s from hostaws-sigv4: region missing in parameters and hostnameaws_sigv4: picked region %.*s from hostx-%.*s-content-sha256awss3UNSIGNED-PAYLOADx-%.*s-content-sha256: %s%Y%m%dT%H%M%SZX-%.*s-Datex-%.*s-date:%s host:%sDate%s: %s ;s3-expresss3-outposts%s %s %s %s %s %.*saws_sigv4: Canonical request (enclosed in []) - [%s]%.*s4_request%s/%.*s/%.*s/%s%.*s4-HMAC-SHA256 %s %s %saws_sigv4: String to sign (enclosed in []) - [%s]%.*s4%saws_sigv4: Signature - %sAuthorization: %.*s4-HMAC-SHA256 Credential=%s/%s, SignedHeaders=%s, Signature=%s %s%schunk hex-length longer than %dchunk hex-length char not a hex digit: 0x%xinvalid chunk size: '%s'http_chunked, chunk start of %lld byteshttp_chunked, write %zu body bytes, %lld bytes in chunk remainhttp_chunk, response completehttp_chunk error, expected 0x0a, seeing 0x%uxOKToo long hexadecimal numberIllegal or missing hexadecimal sequenceMalformed encoding foundBad content-encoding foundFailed reading the chunked-encoded stream%s in chunked-encodingLeftovers after chunking: %zu bytestransfer closed with outstanding read data remaining%zx http_chunk, made chunk of %zu bytes -> %dhttp_chunk, added last, empty chunk0 0 operation aborted by trailing headers callbackMalformatted trailing header, skipping trailerhttp_chunk, added last chunk with trailers from client -> %d%sAuthorization: Digest %s NTLM auth restartedNTLM handshake rejectedNTLM handshake failure (internal error)HTTP%sAuthorization: NTLM %s CONNECT: '%s' negotiatedhttp/1.0CONNECT: no ALPN negotiatedinstalling subfilter for HTTP/1.0installing subfilter for HTTP/1.1CONNECT: negotiated ALPN '%s' not supported%s%s%s:%dAuthorization:HTTP-PROXY%%%u%c%03dmeta:proto:imap:connLOGOUTUID FETCH %s BODY[%s]<%s>UID FETCH %s BODY[%s]Cannot FETCH without a UID.() {%*]\"LIST "%s" *meta:proto:imap:easyAUTHENTICATE %s %sAUTHENTICATE %sPREAUTH* CAPABILITYSTORESELECTFETCHEXAMINESEARCHEXPUNGELSUBUIDGETQUOTAROOTNOOP+ Unexpected continuation responseLOGIN %s %sPREAUTH connection, already authenticatedGot unexpected imap-server responseSTARTTLSLOGINDISABLEDSASL-IRAUTH=STARTTLS not available.STARTTLS deniedAuthentication cancelledAccess denied. %cOK [UIDVALIDITY Mailbox UIDVALIDITY has changedSEARCH %sSelect failedFound %lld bytes to downloadWritten %zu bytes, %llu bytes are left for transferFailed to parse FETCH response.AUTH=+LOGINUIDVALIDITYMAILINDEXSECTIONPARTIALCannot APPEND without a mailbox.Mime-VersionMime-Version: 1.0Cannot APPEND with unknown input file sizeAPPEND %s%s {%lld}Cannot SELECT without a mailbox.SELECT %sAnsweredDeletedDraftFlaggedSeenimapimapsCannot rewind mime/post data ---- Could only read %lld bytes from the mime postMime post already completely uploadedcr_mime_read(len=%zu) is errored -> %d, eos=0cr_mime_read(len=%zu) seen eos -> 0, eos=1cr_mime_read(len=%zu), small read, using tmpcr_mime_read(len=%zu), mime_read() -> %zdclient mime read EOF fail, only %lld/%lld of needed bytes readoperation aborted by callbackcr_mime_read(len=%zu), paused by callbackread error getting mime dataread function returned funny valuecr_mime_read(len=%zu, total=%lld, read=%lld) -> %d, %zu, %dbinarymultipart/mixedattachment; name="; filename="; boundary=8bitform-datatext/plainContent-Dispositionmultipart/Content-Disposition: %s%s%s%s%s%s%sContent-Type: %s%s%sContent-Transfer-EncodingContent-Transfer-Encoding: %s\\\"\""%22 %0D %0A.gifimage/gif.jpgimage/jpeg.jpeg.pngimage/png.svgimage/svg+xml.txt.htmtext/html.html.pdfapplication/pdf.xmlapplication/xmlcr-mime7bitbase64quoted-printable.%dmeta:proto:mqtt:easyToo long MQTT topicNo MQTT topic found. Forgot to URL encode it?meta:proto:mqtt:connClient ID length mismatched: [%zu]Using client id '%s'Username too long: [%zu]Password too long: [%zu]Error %d sending MQTT CONNECT requestGot DISCONNECTRemaining length: %zu bytesEEEE AAAAGAINserver disconnectedmqtt_ping: sent ping request.mqtt_doing: state [%d]Connection disconnectedReceived ping response.Expected %02x%02x but got %02x%02xState not handled yetmqtt-> [%s]multi_done_locked, in use=%uConnection still in use %u, no more multi_done now!multi_done, terminating conn #%lld to %s:%d, forbid=%d, close=%d, premature=%d, conn_multiplex=%dmulti_done, conn #%lld to %s:%d was shutdown by server, not reusingConnection #%lld to host %s:%d left intactINmulti_getsock: unexpected multi state %derror determining pollset: %d%s pollset[] has POLLIN, but there is still buffered input to consume -> mark as dirty%s pollset[], timeouts=%zu, paused %d/%d (r/w)%s pollset[fd=%d %s%s], timeouts=%zu%s pollset[fd=%d %s%s, fd=%d %s%s], timeouts=%zu%s pollset[fds=%u], timeouts=%zuWARNING: no socket in pollset or timer, transfer may stall!Curl_multi_will_close fd=%dInternal error removing splay node = %d[TIMEOUT] set %s to expire in %lldns[TIMEOUT] cleared %sInternal error clearing splay node = %d[TIMEOUT] all clearedtransfer has no multi handletransfer buffer size is 0attempt to borrow xfer_buf when already borrowedcould not allocate xfer_buf of %zu bytestransfer upload buffer size is 0attempt to borrow xfer_ulbuf when already borrowedcould not allocate xfer_ulbuf of %zu bytesattempt to borrow xfer_sockbuf when already borrowedcould not allocate xfer_sockbuf of %zu bytesinvalid easy handle in xfer table for mid=%udirty transfer %u no longer foundmulti_timeout() says this has expiredmulti_done: status: %d prem: %d done: %dResolving timed out after %lld millisecondsConnection timed out after %lld millisecondsOperation timed out after %lld milliseconds with %lld out of %lld bytes receivedOperation timed out after %lld milliseconds with %lld bytes receivedmulti_cleanup, closing admin handle, doneincreasing xfer table size to %uadded to multi, mid=%u, running=%u, total=%uremoved from multi, mid=%u, running=%u, total=%ucurl_multi_fdsetcurl_multi_waitfdsmulti_waitmulti_wait(fds=%d, timeout=%d) tinternal=%ldmulti changed, check CONNECT_PEND queueCurl_resolv_check() -> %d, %soperation aborted by pre-request callbacksub xfer done for master %umaster easy %u without sub_xfer_done callback.master easy %u already gone.multi_perform(running=%u)PENDING handle timeoutmulti_run_dirtymulti_run_dirty, %u no longer foundev update fd=%d, action '%s%s' -> '%s%s' (%d/%d r/w)ev update call(fd=%d, ev=%s%s)ev %s, call(fd=%d, ev=REMOVE)ev assessmeta:mev:psev new entry fd=%dev entry fd=%d, added %s #%lld, total=%u/%d (xfer/conn)ev entry fd=%d, conn lost interest but is not registeredev entry fd=%d, transfer lost interest but is not registeredev entry fd=%d, removed transfer, total=%u/%d (xfer/conn)last user gonesocket transfer %u no longer foundsocket donemacdefmachineloginno such fileno matching entryout of memorysyntax errorHOME%s%s.netrcMondayTuesdayWednesdayThursdayFridaySaturdaySundayJanFebMarAprMayJunJulAugSepOctNovDecMonTueWedThuFriSatSunserver response timeoutselect/poll errorresponse reading failed (errno: %d)meta:proto:pop3:conn . AUTH %s %s-ERR+OKmeta:proto:pop3:easyCAPA+APOPAPOP %s %sGot unexpected pop3-server responseSTLSSASL STLS not supported.Authentication failed: %dAPOPDELEMSGRSETSTATTOPUIDLXTNDpoppop3spop3--:--:--%2lld:%02lld:%02lld%3lldd %02lldh%7lldd%5lld%4lldk%2lld.%0lldM%4lldM%2lld.%0lldG%4lldG%4lldT%4lldPCallback aborted** Resuming transfer from byte position %lld %% Total %% Received %% Xferd Average Speed Time Time Time Current Dload Upload Total Spent Left Speed %3lld %s %3lld %s %3lld %s %s %s %s %s %s %sWe are completely uploaded and fineRequest completely sent offabort upload after having sent %lld bytesabort uploadupload completely sent off: %lld bytesShutdown send direction error: %d. Broken server? Proceeding as if everything is ok.meta:proto:rtsp:connmeta:proto:rtsp:easyThe CSeq of this request %ld did not match the response %ldGot an RTP Receive with a CSeq of %ldServer prematurely closed the RTSP connection.GET_PARAMETERSET_PARAMETERRECORDAccept: application/sdp DESCRIBEANNOUNCETEARDOWNPLAYGot invalid RTSP requestGot invalid RTSP request: RTSPREQ_LASTRefusing to issue an RTSP request [%s] without a session ID.TransportTransport: %s Refusing to issue an RTSP SETUP without a Transport: header.Range: %s CSeqCSeq cannot be set as a custom header.SessionSession ID cannot be set as a custom header.%s %s RTSP/1.0 CSeq: %ld Session: %s %s%s%s%s%s%s%s%sContent-Type: text/parameters Content-Type: application/sdp Failed sending RTSP requestCannot write a 0 size RTP packet.Cannot pause RTPFailed writing RTP dataCSeq:Unable to read the CSeq header: [%s]Session:Got a blank Session IDGot RTSP Session ID Line [%s], but wanted ID [%s]Transport:interleaved=Unable to read the interleaved parameter from Transport header: [%s]rtspgrowing pollset capacity from %u to %udownload_write header(type=%x, blen=%zu) -> %ddownload_write body(type=%x, blen=%zu), did not want a BODYend of response with %lld bytes missingdownload_write body(type=%x, blen=%zu) -> %dExcess found writing body: excess = %zu, size = %lld, maxdownload = %lld, bytecount = %lldExceeded the maximum allowed file size (%lld) with %lld bytesCould only read %lld bytes from the inputclient read function EOF fail, only %lld/%lld of needed bytes readRead callback asked for PAUSE when not supportedcr_in_read, callback returned CURL_READFUNC_PAUSEcr_in_read(len=%zu, total=%lld, read=%lld) -> %d, nread=%zu, eos=%dcr_buf_read(len=%zu) -> 0, nread=%zu, eos=%dcr_in, rewind via set.seek_func -> %dseek callback returned error %dcr_in, rewind via set.ioctl_func -> %dioctl callback returned error %dnecessary data rewind was not possiblecr_in, rewind via fseek -> %d(%d)cr_lc_read(len=%zu) -> %d, nread=%zu, eos=%dclient_reset, will rewind readerclient_reset, clear readersclient start, rewind readersrewind of client reader '%s' failed: %dclient_write(type=%x, len=%zu) -> %dadd fread reader, len=%lld -> %dclient_read(len=%zu) -> %d, nread=%zu, eos=%dclient reader needs rewind before next requestadd buf reader, len=%zu -> %dcr-bufcr-nullcr-lineconvcr-inrawALLFLUSHRELOADboolean setopt(%d) got unsupported argument %ld, treated as %dsetopt 0x%x got bad argumentmeta:proto:smb:connmeta:proto:smb:easymissing share in URL path for SMBSMB\\%s\%s%c%s?????%s%c%s%c%s%c%scurlarm-muntsos-linux-gnueabihfSMB upload needs to know the size up frontInvalid input packetsmbssmbstate change from %s to %smeta:proto:smtp:connsmtp_disconnect(), finished. . meta:proto:smtp:easysmtp_setup_connection() -> %dRCPT TO:<%s@%s>%sRCPT TO:<%s>%s SMTPUTF8HELPVRFY %s%s%s%sEXPN%s %s%ssmtp_done(status=%d, premature=%d) -> %dEHLO %sGot unexpected smtp-server response: %dHELO %sRemote access denied: %dSMTPUTF8AUTH STARTTLS not supported.Unexpectedly short EHLO responseSTARTTLS denied, code %dCommand failed: %dMAIL failed: %dRCPT failed: %dRCPT failed: %d (last error)DATA failed: %dsmtp_doing() -> %d, done=%d AUTH= SIZE=smtp_perform(), start<>MAIL FROM:%s%s%s%s%s%ssmtp_perform() -> %d, connected=%d, done=%dsmtp_regular_transfer() -> %d, done=%dsmtp_do() -> %d, done=%dSERVERGREETEHLOHELOUPGRADETLSCOMMANDMAILRCPTPOSTDATAcr-smtp-eobsmtpsmtpsSOCKS: Failed receiving %s: %sconnection to proxy closedFailed to send %s: %s HTTP proxySOCKS5: connecting to HTTP proxy %s port %dSOCKS5: the destination hostname is too long to be resolved remotely by the proxy.warning: unsupported value passed to CURLOPT_SOCKS5_AUTH: %uinitial SOCKS5 requestinitial SOCKS5 responseReceived invalid version in initial SOCKS5 response.SOCKS5 GSSAPI per-message authentication is not supported.No authentication method was acceptable.Undocumented SOCKS5 mode attempted to be used by server.Excessive username length for proxy authExcessive password length for proxy authSOCKS5 sub-negotiation requestSOCKS5 sub-negotiation responseUser was rejected by the SOCKS5 server (%d %d).Failed to resolve "%s" for SOCKS5 connect.SOCKS5 connect to %s:%d (locally resolved)SOCKS5 connect to [%s]:%d (locally resolved)SOCKS5 connection to %s not supportedSOCKS5 connect to %s:%d (remotely resolved)SOCKS5 connect requestSOCKS5 connect request ackSOCKS5 reply has wrong version, version should be 5.cannot complete SOCKS5 connection to %s. (%d)SOCKS5 reply has wrong address type.SOCKS5 connect request addressSOCKS5 request granted.SOCKS4%s communication to%s %s:%dSOCKS4 non-blocking resolve of %sSOCKS4 connect to IPv4 %s (locally resolved)SOCKS4 connection to %s not supportedFailed to resolve "%s" for SOCKS4 connect.Too long SOCKS proxy usernameSOCKS4: too long hostnameSOCKS4 connect requestconnect request ackSOCKS4 reply has wrong version, version should be 0.SOCKS4%s request granted.[SOCKS] cannot complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected or failed.[SOCKS] cannot complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected because SOCKS server cannot connect to identd on the client.[SOCKS] cannot complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected because the client program and identd report different user-ids.[SOCKS] cannot complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), Unknown.unknown proxytype option givenOpened %sSOCKS connection from %s port %u to %s port %u (via %s port %u)SOCKSOperation too slow. Less than %ld bytes/sec transferred the last %ld secondsNo errorUnsupported protocolFailed initializationURL using bad/illegal format or missing URLA requested feature, protocol or option was not found built-in in this libcurl due to a build-time decision.Could not resolve proxy nameCould not resolve hostnameCould not connect to serverWeird server replyAccess denied to remote resourceFTP: The server failed to connect to data portFTP: Accepting server connect has timed outFTP: The server did not accept the PRET command.FTP: unknown PASS replyFTP: unknown PASV replyFTP: unknown 227 response formatFTP: cannot figure out the host in the PASV responseError in the HTTP2 framing layerFTP: could not set file typeTransferred a partial fileFTP: could not retrieve (RETR failed) the specified fileQuote command returned errorHTTP response code said errorFailed writing received data to disk/applicationUpload failed (at start/before it took off)Failed to open/read local data from file/applicationTimeout was reachedFTP: command PORT failedFTP: command REST failedRequested range was not delivered by the serverSSL connect errorCould not resume downloadCould not read a file:// fileLDAP: cannot bindLDAP: search failedOperation was aborted by an application callbackA libcurl function was given a bad argumentFailed binding local connection endNumber of redirects hit maximum amountAn unknown option was passed in to libcurlMalformed option provided in a setoptServer returned nothing (no headers, no data)SSL crypto engine not foundCan not set SSL crypto engine as defaultFailed to initialise SSL crypto engineFailed sending data to the peerFailure when receiving data from the peerProblem with the local SSL certificateCould not use specified SSL cipherSSL peer certificate or SSH remote key was not OKProblem with the SSL CA cert (path? access rights?)Unrecognized or bad HTTP Content or Transfer-EncodingRequested SSL level failedFailed to shut down the SSL connectionFailed to load CRL file (path? access rights?, format?)Issuer check against peer certificate failedSend failed since rewinding of the data stream failedLogin deniedTFTP: File Not FoundTFTP: Access ViolationDisk full or allocation exceededTFTP: Illegal operationTFTP: Unknown transfer IDRemote file already existsTFTP: No such userRemote file not foundError in the SSH layerSocket not ready for send/recvRTSP CSeq mismatch or invalid CSeqRTSP session errorUnable to parse FTP file listChunk callback failedThe max connection limit is reachedSSL public key does not match pinned public keySSL server certificate status verification FAILEDStream error in the HTTP/2 framing layerAPI function called from within callbackAn authentication function returned an errorHTTP/3 errorQUIC connection errorproxy handshake errorSSL Client Certificate requiredUnrecoverable error in select/pollA value or data field grew larger than allowedECH attempted but failedUnknown errorPlease call curl_multi_perform() soonInvalid multi handleInvalid easy handleInternal errorInvalid socket argumentUnknown optionThe easy handle is already added to a multi handleWakeup is unavailable or failedUnknown share optionShare currently in useInvalid share handleFeature not enabled in this libraryCURLSHcode unknownAn invalid CURLU pointer was passed as argumentAn invalid 'part' argument was passed as argumentMalformed input to a URL functionPort number was not a decimal number between 0 and 65535Unsupported URL schemeURL decode error, most likely because of rubbish in the inputA memory function failedCredentials was passed in the URL when prohibitedAn unknown part ID was passed to a URL API functionNo scheme part in the URLNo user part in the URLNo password part in the URLNo options part in the URLNo host part in the URLNo port part in the URLNo query part in the URLNo fragment part in the URLNo zoneid part in the URLBad login partBad IPv6 addressBad hostnameBad file:// URLUnsupported number of slashes following schemeBad schemeBad pathBad fragmentBad queryBad passwordBad userlibcurl lacks IDN supportA value or data field is larger than allowedCURLUcode unknownUnknown error %dmeta:proto:telnet:easyRCVDSENT%s IAC SB (terminated by %u , not IAC SE) (Empty suboption?)%s (unsupported)%d (unknown)Width: %d ; Height: %d IS SEND INFO/REPLY NAME "%s" = %.2xWILLWONTDONTEXOPL%s IAC %s%s IAC %d%s %s %s%s %s %dSending data failed (%d)%c%c%c%c%s%c%c%c%s%c%.*s%c%sXDISPLOCNEW_ENVSyntax error in telnet option: %sBINARYUnknown telnet option %scannot read inputIn SUBOPTION processing, RCVDTime-outUSER,%stelnetEOFSUSPABORTEORSENOPDMARKBRKIPAOAYTECELGASBIACECHORCPSUPPRESS GO AHEADSTATUSTIMING MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND ASCIIBYTE MACRODE TERMINALSUPDUPSUPDUP OUTPUTSEND LOCATIONTERM TYPEEND OF RECORDTACACS UIDOUTPUT MARKINGTTYLOC3270 REGIMEX3 PADNAWSTERM SPEEDLFLOWLINEMODEOLD-ENVIRONAUTHENTICATIONENCRYPTNEW-ENVIRONset timeouts for state %d; Total % lld, retry %d maxtry %dReceived last DATA packet block %d again.Received unexpected DATA packet block %d, expecting block %dTimeout waiting for block %d ACK. Retries = %dtftp_rx: internal errorConnected for receiveReceived ACK for block %d, expecting %dtftp_tx: giving up waiting for block %d ackTimeout waiting for block %d ACK. Retries = %dtftp_tx: internal error, event: %iConnected for transmitmeta:proto:tftp:connbind() failed; %s;mode=octetnetasciiTFTP filename too long%s%c%s%ctsizeblksizeTFTP buffer too small for optionstftp_send_first: internal errorTFTP finishedInternal state machine errorReceived too short packetTFTP error: %sMalformed ACK packet, rejectinggot option=(%s) value=(%s)blksize is larger than max supportedinvalid blocksize value in OACK packetblksize is smaller than min supportedserver requested blksize larger than allocated (%lld)blksize parsed from OACK (%d) requested (%d)invalid tsize -:%s:- value in OACK packettsize parsed from OACK (%lld)Internal error: Unexpected packettftpxfer_setup: recv_idx=%d, send_idx=%dNo URL setcannot mix POSTFIELDS with RESUME_FROMUser-Agent: %s REFUSED_STREAM, retrying a fresh connectConnection died, tried %d times before giving upConnection died, retrying a fresh connect (retry count: %d)xfer_write_resp(len=%zu, eos=%d) -> %dsendrecv_dl() no EAGAIN/pending data, mark as dirtywe are done reading and this is set to close, stop sendtransfer closed with %lld bytes remaining to read%lld-Invalid zoneid: %s; %ssocks5hsocks5socks4asocks4socksUnsupported proxy scheme for '%s'Unsupported proxy syntax in '%s': %sUnsupported proxy '%s', libcurl is built without the HTTPS-proxy support.localhost%sFound pending candidate for reuse and CURLOPT_PIPEWAIT is setToo old connection (%lld ms idle, max idle is %lld ms), disconnect itToo old connection (created %lld ms ago, max lifetime is %lld ms), disconnect itConnection %lld seems to be deadConnection #%lld is not open enough, cannot reuseServer upgrade does not support multiplex yet, waitServer upgrade cannot be usedclient side MAX_CONCURRENT_STREAMS reached, skip (%u)Multiplexed connection founddisabled (in redirect)no_proxyNO_PROXYall_proxyALL_PROXYftp@example.comanonymous (upgraded to SSL)%s://%sURL rejected: %sToo long hostname (maximum is %d)Switched from HTTP to HTTPS due to HSTS => %sProtocol "%s" %s%smemory shortageUses proxy env variable %s == '%s'%s_proxyhttp_proxyws_proxywss_proxyhttps_proxyHTTPS_PROXYCouldn't find host %s in the %s file; using defaults.netrc error: %scontrol code detected in .netrc credentialsPlease URL encode %% as %%25, see RFC 6874.Invalid IPv6 address formatNo valid port number in connect to host string (%s)Connecting to hostname: %sConnecting to port: %dAlt-svc connecting from [%s]%s:%d to [%s]%s:%d%u/%d/%sReusing existing %s: connection%s with %s %sWaiting on connection to negotiate possible multiplexing.No more connections allowed to hostAllowing sub-requests (like DoH) to override max connection limitNo connections available, total of %ld reached.NTLM picked AND auth done set, clear pickedNTLM-proxy picked AND auth done set, clear pickedlocalhost/Unix socket path too long: '%s'Failed to resolve %s '%s' with timeout after %lld msCould not resolve %s: %s0123456789abcdefABCDEF:.//+ /:#?!@{}[]\$'"^`*<>=;,+&()%ldap127.0.0.1//?#ftp.dict.ldap.imap.smtp.pop3.#file://%s%s%s%s%s%.*s%%25%s]%s://%s%s%s%s%s%s%s%s%s%s%s%s%s%s%slibcurl/8.16.0zlib/%salt-svcAsynchDNSHTTPS-proxyIPv6LargefilelibzthreadsafeTLS-SRPUnixSocketswswssws_send_raw_blocking() partial, %zu left to send[WS] Timeout waiting for socket becoming writable[WS] Error while waiting for socket becoming writableflush EAGAIN, %zu bytes remain in buffer[WS] flush, write error %dflushed %zu bytesCONTBINCLOSEPINGPONG NON-FINWS-ENC: %s [%s%s payload=%lld/%lld][WS] starting new frame with negative payload length %lld[WS] starting new frame with %zd bytes from last one remaining to be sentno flags given; interpreting as continuation fragment for compatibility[WS] no flags given[WS] setting CURLWS_CONT flag without message type is supported for compatibility but highly discouraged[WS] No ongoing fragmented message to continue[WS] CLOSE frame must not be fragmented[WS] PING frame must not be fragmented[WS] PONG frame must not be fragmented[WS] unknown flags: %x[WS] given PING frame is too big[WS] given PONG frame is too big[WS] given CLOSE frame is too bigbufferedws_enc_cntrl(), error addiong head: %dws_enc_cntrl(), error adding payload: %dauto PONG to [PING payload=%lld/%lld]meta:proto:ws:conn[WS] not a websocket transfercurrent frame, %lld remainingcr_ws_read, added %zu payload, len=%zucr_ws_read(len=%zu) -> %d, nread=%zu, eos=%d NON-FINALdecoded %s [%s%s]decoded %s [%s%s](%d/%d)decoded %s [%s%s payload=%lld/%lld][WS] no ongoing fragmented message to resume[WS] fragmented message interrupted by new TEXT msg[WS] fragmented message interrupted by new BINARY msg[WS] invalid fragmented CLOSE frame[WS] invalid fragmented PING frame[WS] invalid fragmented PONG frame[WS] invalid reserved bits: %02x[WS] invalid opcode: %02x[WS] masked input frame[WS] received PING frame is too big[WS] received PONG frame is too big[WS] received CLOSE frame is too big[WS] frame length longer than 64 signed not supported[WS] unexpected frame header lengthdecoded[WS] decode frame error %dpassed %zu bytes payload, %lld remainpassingws_cw_write(len=%zu, type=%d)[WS] error adding data to buffer %d[WS] decode payload error %d[WS] decode ending with %zd frame bytes remainingconnect-onlyWS, using chunk size %zu[WS] Received 101, switch to WebSocketUPLOAD set, add ws-encode readerCurl_ws_accept() failed -> %dwebsocket established, %s mode[WS] CONNECT_ONLY is required[WS] connection not found[WS] connection is not setup for websocket[WS] connection expectedly closed?curl_ws_recv, added %zu bytes from networkneed more inputcurl_ws_recv(len=%zu) -> %zu bytes (frame at %lld, %lld left)curl_ws_send(len=%zu, fragsize=%lld, flags=%x), raw=%d[WS] buffer is NULL when buflen is not[WS] No associated connection[WS] Not a websocket transfer[WS] buffer is NULL in raw mode[WS] sent is NULL in raw mode[WS] fragsize and flags must be zero in raw modews_send_raw(len=%zu) -> %d, %zu[WS] curl_ws_send() called with smaller 'buflen' than bytes already buffered in previous call, %zu vs %zu[WS] unaligned frame size (sending %zu instead of %lld)curl_ws_send(), error writing frame head %dEAGAIN flushing sendbuf, payload_encoded: %zu/%zucurl_ws_send(len=%zu, fragsize=%lld, flags=%x, raw=%d) -> %d, %zucannot curl_ws_start_frame() with CURLWS_RAW_MODE enabledcurl_ws_start_frame(flags=%x, frame_len=%lld[WS] cannot start frame in raw mode[WS] previous frame not finishedcurl_start_frame(), error adding frame head %dwebsocketSec-WebSocket-Version13Sec-WebSocket-KeyWSSws-encodews-decode%s %02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%s:%s:%sauth-int%s:%s:%08x:%s:%s:%susername="%s", realm="%s", nonce="%s", uri="%s", cnonce="%s", nc=%08x, qop=%s, response="%s"username="%s", realm="%s", nonce="%s", uri="%s", response="%s"%s, opaque="%s"%s, algorithm=%s%s, userhash=truenonce="realm="algorithm=qop="md5-sessauth-confusername="%s",realm="%s",nonce="%s",cnonce="%s",nc="%s",digest-uri="%s",response=%s,qop=%s00000001AUTHENTICATEnoncestaletruerealmopaqueqopMD5-sessSHA-256SHA-256-SESSSHA-512-256SHA-512-256-SESSuserhashNTLMSSPNTLM handshake failure (bad type-2 message)NTLM handshake failure (bad type-2 message). Target Info Offset Len is set incorrect by the peerNTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%s%sNTLMSSP%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%c%cincoming NTLM message too biguser + domain + hostname too bign,a=%s,host=%sauth=Bearer %sn,a=%s,host=%sport=%ldauth=Bearer %suser=%sauth=Bearer %s%s/%s@%s%s/%s%s@%s\/@meta:auth:ntml-proxy:connmeta:auth:ntml:connSSLKEYLOGFILESSL_ERROR_NONESSL_ERROR_SSLSSL_ERROR unknownSSL_ERROR_WANT_CLIENT_HELLO_CBSSL_ERROR_WANT_X509_LOOKUPSSL_ERROR_SYSCALLSSL_ERROR_ZERO_RETURNSSL_ERROR_WANT_CONNECTSSL_ERROR_WANT_ACCEPTSSL_ERROR_WANT_ASYNCSSL_ERROR_WANT_ASYNC_JOBSSLv3TLSv1.0TLSv1.1TLSv1.2TLSv1.3TLS change cipherSSLv2TLS alertTLS UnknownTLS app dataTLS handshakeChange cipher specMessage hashNext protocolKey updateEnd of early dataSupplemental dataEncrypted ExtensionsCertificate StatusFinishedCERT verifyServer finishedRequest CERTClient key exchangeServer key exchangeCertificateNewsession TicketServer helloClient helloHello request(%x)%s (%s), %s, %s (%d): OpenSSL(null)Failed to find the SSL filterUnable to find digest NID for certificate signature algorithmCould not find digest algorithm %s (NID %d)X509_digest() failedtls-server-end-point:set default crypto engine '%s'set default crypto engine '%s' failedSSL session does not allow earlydataSSL session has different ALPN, no early dataSSL session allows %zu bytes of early data, reusing ALPN '%s'ossl_bio_cf_out_write(len=%d) -> %d, %zuPEMPROVENGP12Failed to load default openssl config. Proceeding.Failed to initialize provider: %sbaseFailed to load baseFailed to initialise SSL Engine '%s': %sOpenSSL SSL_write: %s, errno %dSSL_write() error: %sOpenSSL SSL_read: %s, errno %dConnection closed abruptlyossl_recv(len=%zu) -> %d, %zu (in_pending=%d)SSL_write_early_data(len=%zu) -> %d, %zuOpenSSL SSL_write:early_data: %s, errno %dSSL_write_early_data() error: %sOpenSSL SSL_write_early_data: %s, errno %dSSL sending %zu bytes of early dataSSL shutdown not sent, read -> %dSSL shutdown received, not sendingpeer closed connectionsend SSL close notifySSL shutdown finishedSSL shutdown still wants to sendSSL shutdown read -> %dSSL shutdown not received, but closedSSL shutdown sent, want receiveSSL shutdown send blockedSSL shutdown, ignore recv error: '%s', errno %dInsufficient randomness%s(%s)tls:ossl:x509:shareossl_populate_x509_store, path=%s, blob=%derror importing CA certificate blobsuccessfully imported CA certificate bloberror setting certificate file: %serror setting certificate file, continuing anywayerror setting certificate path: %serror setting certificate path, continuing anyway CAfile: %s CApath: %serror loading CRL file: %ssuccessfully loaded CRL file: CRLfile: %sossl_bio_cf_in_read(len=%d) -> %d, %zuCURLOPT_SSLCERT_BLOB(memory blob)No SSLv2 supportNo SSLv3 supportUnrecognized parameter passed via CURLOPT_SSLVERSIONQUIC needs at least TLS version 1.3unsupported transport %d in SSL initSSL: could not create a context: %sfailed setting cipher list: %sCipher selection: %sfailed setting TLS 1.3 cipher suite: %sTLS 1.3 cipher selection: %scould not load PEM client certificate from %s, OpenSSL error %s, (no key found, wrong pass phrase, or wrong file format?)could not load ASN1 client certificate from %s, OpenSSL error %s, (no key found, wrong pass phrase, or wrong file format?)pkcs11:pkcs11LOAD_CERT_CTRLssl engine does not support loading certificatesssl engine cannot load client cert with id '%s' [%s]ssl engine did not initialized the certificate properly.unable to set client certificate [%s]crypto engine not set, cannot load certificateFailed to open OpenSSL store: %sFailed to set store preference. Ignoring the error: %sNo cert found in the openssl store: %scrypto provider not set, cannot load certificateBIO_new_mem_buf NULL, OpenSSL error %sBIO_new return NULL, OpenSSL error %scould not open PKCS12 file '%s'error reading PKCS12 file '%s'could not parse PKCS12 file, check password, OpenSSL error %scould not load PKCS12 client certificate, OpenSSL error %sunable to use private key from PKCS12 file '%s'private key from PKCS12 file '%s' does not match certificate in same filecannot add certificate to client CA listcannot add certificate to certificate chainnot supported file type '%s' for certificateunable to set private key file: '%s' type %scurl user interfaceunable do create OpenSSL user-interface methodfailed to load private key from crypto engineunable to set private keycrypto engine not set, cannot load private keyNo private key found in the openssl store: %sunable to set private key [%s]crypto provider not set, cannot load private keynot supported file type for private keyunable to create an SSL structurePrivate key does not match the certificate public keyfailed setting curves list: '%s'failed setting signature algorithms: '%s'Using TLS-SRP username: %sUnable to set SRP usernamefailed setting SRP passwordSetting cipher list SRPfailed setting SRP cipher listerror signaled by ssl ctx callbackSSL: could not create a context (handle)Failed set SNISSL: SSL_set_session not accepted, continuing without: %sSSL reusing session with ALPN '%s'SSL session not accepted by OpenSSL, continuing withoutError determining ALPNError setting ALPNfile type P12 for private key not supported[blank]SSL connection using %s / %s / %s / %sSSL_connect() -> err=%d, detail=%dSSL_connect() -> want recvSSL_connect() -> want sendSSL_connect() -> want asyncSSL_connect() -> want retry_verifySSL certificate problem: %sSSL certificate verification failedTLS cert problem: %sTLS connect error: %sOpenSSL SSL_connect: %s in connection to %s:%d [NONE]ipv6 addressipv4 addressSubjectIssuer%lxVersionSerial NumberSignature AlgorithmPublic Key AlgorithmStart dateExpire date Unable to load public keyRSA Public Keyrsaqpubdsapub_keySignature%02x:CertSSL: could not get peer certificate%s certificate: subject: %s start date: %.*s expire date: %.*sunexpected ssl peer type: %d subjectAltName: host "%s" matched cert's "%.*s" subjectAltName: host "%s" matched cert's IP address! subjectAltName does not match %s %sSSL: no alternative certificate subject name matches target %s '%s'vtls/openssl.cSSL: illegal cert name fieldSSL: unable to obtain common name from peer certificateSSL: certificate subject name '%s' does not match target hostname '%s' common name: %s (matched)SSL: could not get X509-issuer name issuer: %sSSL: Unable to open issuer cert (%s)SSL: Unable to read issuer cert (%s)SSL: Certificate issuer check failed (%s) SSL certificate issuer check ok (%s)SSL certificate verify result: %s (%ld) SSL certificate verify result: %s (%ld), continuing anyway. SSL certificate verify ok. Certificate level %d: Public key type %s%s (%d/%d Bits/secBits), signed using %sNo OCSP response receivedInvalid OCSP responseInvalid OCSP response status: %s (%d)Could not get peer certificate chainOCSP response verification failedError getting peer certificateError computing OCSP IDCould not find certificate ID in OCSP responseOCSP response has expiredSSL certificate status: %s (%d)SSL certificate revocation reason: %s (%d)SSL: public key does not match pinned public keyossl_connect, step1OpenSSL CF BIOALPN: curl offers %sossl_connect, step2ossl_connect, step3ossl_connect, doneopenssl(cf_shutdown -> %d, done=%dCURL_SSL_BACKENDquery ALPN: returning '%s'adjust_pollset, POLLOUT fd=%dadjust_pollset, POLLIN fd=%dsha256// public key hash: sha256//%s;sha256//-----BEGIN PUBLIC KEY----- -----END PUBLIC KEY-----cf_connect()Unrecognized parameter value passed via CURLOPT_SSLVERSIONCURL_SSLVERSION_MAX incompatible with CURL_SSLVERSIONcf_connect() -> %d, done=%dssl_cf_set_earlydata(len=%zu) -> %zdServer accepted %zu bytes of TLS early data.Server rejected TLS early data.shutdown and remove SSL, startSSL shutdown timeoutselect/poll on SSL socket, errno: %dshutdown and remove SSL, done -> %dALPN: asked for '%s' from previous session, but server did not confirm it. Refusing to continue.ALPN: asked for '%s' from previous session, but server selected '%.*s'. Refusing to continue.ALPN: server confirmed to use '%s'ALPN: server selected protocol contains NUL. Refusing to continue.ALPN: deferred handshake for early data using '%.*s'.ALPN: server accepted %.*sALPN: deferred handshake for early data without specific protocol.ALPN: server did not agree on a protocol. Uses default.SSL-PROXYmulti:%s-%s:%s-transfer would use an invalid scache at %p, deniedfind peer slot for %s among %zu slotspeer entry %zu key recovered: %speer not found for %s:L:G:UDP:QUIC:UNIX:TRNSPRT-%d:NO-VRFY-PEER:NO-VRFY-HOST:VRFY-STATUS:CHOST-%s:CPORT-%d:TLSVER-%d-%d:TLSOPT-%x:CIPHER-%s:CIPHER13-%s:CURVES-%sCACApathCRLCertBlobCAInfoBlobIssuerBlob:Pinned-%s:CCERT:SRP-AUTH:IMPL-%syesnoadd, session already expiredunable to add scache peer: %d[SCACHE] failed to add session for %s, error=%dadded session for %s [proto=0x%x, valid_secs=%lld, alpn=%s, earlydata=%zu, quic_tp=%s], peer has %zu sessions nowtook session for %s [proto=0x%x, alpn=%s, earlydata=%zu, quic_tp=%s], %zu sessions remainno cached session for %sFoundNo%s cached session for '%s'2iO–U[?92 )/host!ifhost!/ KGS!@#$%rvb...I9.* < > { } { } * < > { } { } %Accept-ranges: bytes ]ZOLh h OI?BjtBB"eXXt Nm>+++++333MM uuEPSVPASVEPRTPORT Accept-ranges: bytes e?.c{(L )   tfXOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO  {wpib[RHDA7% ]ZWTQNKHEB?81.+QT]]]]]]]]Z]]]]]]]]]W6\ ub('";;;;;;;;;S;;;4;~;;;;;;;;;;;;;;;;;;;;S;;;4;~;;4OaX)&"630-/'zjH'$))B2clgK0%"JQ'0123456789ABCDEFIF740 LTOWSVY@H\k_giK8kh,,, 80123456789abcdef0123456789ABCDEF(nil)KKU2xxddC?; 71&3/+[R4"y GMTUTUTCWETBSTWAT<ASTADTEST,EDTCSThCDT,MSTMDThPSTPDTYSTYDTHSTXHDTCATXAHSTXNTIDLWCETMETMEWTMESTCESTMESZFWTFSTEETWAST\WADT CCT JSTEASTEADTlGSTNZT0NZST0NZDTIDLE0A<BxCDE,FhGHIKXLMNOPLQRST\U VWXlY0Z;Zx0N_T>6&.:ELX]dk")0 |xslf[TNPLHA:0,&   {bZT|C<61& zyvsp|me    %9#1B^W NT LM 0.12fH>-"}cWA kVkVmKX\cOkK9'  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~~{xurolifc`]ZWTQNKHEB?<9630-*'$!  !$' ]ZWTQNKHEB?<9630-*'$! \M7:%&ǻ\#=?z_cD "C.\٣6v(S3fŻ%'$!5zkpmdgajtnk66666hebQK9630rkkkkkdddddsWORKSTATION MJ0P)BE>:62.*&"  $(@>'*P777C;7777oouwss22222d22^I:D4R4<ʊÂhttp/1.1 |>?456789:;<=  !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_  >A AA'A6AAAAAA&AA)AAA A A X @ ,4 Љ܎P@8tlP@h@4 ( L@`T   < H P X ` h p x   (8L\lxHPxX`lx,, @ LXD @t Xdt(v'/(2:A(b Q'u q'(A<HN\'hN|'NN(NNN &'(/'4b'@'L`\'lt'|*(4'o'~N'0\'' '0'<T[l324'(U(]'v''-'E'$N84HKXJh2t0!'''np w j0U@PdS(h*-'oN<(>(MO@(OO+(8x'HkTP\''h('t=T'uN''N('4NDqP'\gl*'O'O'''' '"0"H TG`rlu:Duu(;3'$,,+8'@cL'\N'p|'/`'<u7'm'I(XO (w' I'0XNDPN( '`ol'x';e''(v((8(i0(@(X'l(|(e((f(4L%(` (x ( (6B,'\''',NO( '('!(,0ODPud''p'''1('N p$D@'Pt'X'dNt ' M(\O'G($'0N@'P'd'x)'*'f' ci'Zg'*'h'd< c'}' N :(0@P`lX(pQ@5'(( F 0@yLV'\l|! 4">v$(''',(;O5$'8iL`.h|G N '"'''w)' +N-'@I'N'Y(@ `X,bbaPL$0,<HT\H(hpxh|Lȶ~zl|4|4|4{إgLȶ~zl|4|4|4{إf <4 F <FT,  lE N4wXWWPP!N4wXWWPPP TH (l + 4)Dt' &4 4    4)Dt' &4 4  @@@\@@@\@@ H P 8 < 4 dJ8B dJ8B @B8B BD  HXFX ` l t  t               < Ȟh [! ! ! ! ! ! ! " " " " " " $" ! ! ! ! ! ! ! ! ! " " " # BA?@*+H# L" P# X#  xh\# d# # l# p# 2 x# # `DpKCF @El@l@ZD<@E# `DpKCF @El@l@ZD<n@@D=  / h / йص$,4Ĺ<4/ @̹d@<0/ ̹$ة,4Ĺ</  ̹  Ĺ<l@ P1   hhX1   hhd4 p4 x4 x 4 L4 4 4 4 x4 P4&0>,3HHE4 <N4 P4&0>,3HHDP lQ tQ xQ Q Q Q Q Q Q Q Q Q Q Q Q Q R R R R 0R @R LR \R hR xR R R R R R R tP R R R R Q $Q ,Q 4Q 8Q |>=T=8  P       $  `   l    Y̹$4,4ĹX8,$,4Ĺ<4 L_LGG^TH<P,(* ȎlЀДPP*4 $,4Ĺ<< ` X h @  X T T 0 o WgW$4,4Ĺ<o X4wXWWPP 0X4wXWWPPP@  X,@I(h y   o` - 4  x wN(oMooPJo ((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((( Th $ :X x P X @   E ` t p hF p; X<  |(0AHA`AA?AA8\H0AtHA`AA?AAB@(`AALAA8 `AA?AA!(2 HA6(A$!. HA6(A!(2 HA6(A!$ HA6(Ax|}0}0A@AHA`AA?AAB,D<40 l0A@AHA`AA?AA8     d= @C@@0AAHA`AA?AAA a 0  To o o o TW4Tx93d3$\<]:3AA TW4Tx93d3$\<]?3AAGCC: (crosstool-NG 1.28.0) 15.2.0A0aeabi&6KZ  "Dd>,|(Ot<(0d , @3:d~,HJttXtte`q`!x#}~ <}~8~:: 9G~(, intzUac.j O9$ Hh< ~|  "   >J8D- 0!"#$ %&'(o)W*" +[,-./0k123456=7M8]9Y:m;}<=>g?@(ABNCf$ Nc 9S+&c>A AA'A6AAAAAA&AA)AAA A A29@+Z xlow  sNll Ox2(x' uu '%ret /-add95 9G~0d intzUac.j O9$ Hh< ~|  "   >J8D- 0!"#$ %&'(o)W*" +[,-./0k123456=7M8]9Y:m;}<=>g?@(ABNCf$ Nc 9S+&c>A AA'A6AAAAAA&AA)AAA A A29@+Z xlow  sNll OxL N20dxN'VRuuTx1 ykx2 X9G~,9ZintzUac.jO9+ Hh< ~|  "   >J8D- 0!"#$ %&'(o)W*" +[,-./0k123456=7M8]9Y:m;}<=>g?@(AB RCf+ Rg 9W +&g>A AA'A6AAAAAA&AA)AAA A A@qq + d ;x Z+Z l ,al.@PQ+@s9G~@)ZintzUac.j O2+ Hh< ~|  "   >J8D- 0!"#$ %&'(o)W*" +[,-./0k123456=7M8]9Y:m;}<=>g?@(AB RCf+ Rg 2W +&g>A AA'A6AAAAAA&AA)AAA A A2 qq +d Y@aY3hi^locd G~ intzUac.j O9$ Hh< ~|  "   >J8D- 0!"#$ %&'(o)W*" +[,-./0k123456=7M8]9Y:m;}<=>g?@(AB KCf$ K` 9P+&`>A AA'A6AAAAAA&AA)AAA A A9+Zl  n ?;d" YUrp.q wor y lz1 lz220i@8ke_ %.?I;%.?I;%.?I;%%%.I;( $ > :!; 9 I : ;9 I8 &I !: ;9  :!;9 I4:!;!9 IB %   $ >  > I: ; 9  I !I/ 4: ;9 I  : ;9 I8  : ;9 : ;9 I.?: ;9 'I@z: ;9 IB4: ;9 I4: ;9 IB( $ > :!; 9 I : ;9 I8 &I !: ;9  :!;9 I4:!;!9 IB %   $ >  > I: ; 9  I !I/ 4: ;9 I  : ;9 I8  : ;9 : ;9 I.?: ;9 'I@z: ;9 IB4: ;9 I( $ > :!; 9 I :!;9!I8 &I%  $ > > I: ; 9   : ;9  I !I/ 4: ;9 I .?: ; 9 n'I<I.?: ;9 'I@z: ;9 IBH}I~H}( $ > &I:!; 9 I :!;9!I8 4:!;9!IB%  $ >  > I: ; 9   : ;9  I !I/ 4: ;9 I .?: ;9 'I@z: ;9 IB( $ > 4:!;9 IB :!;9!I8 &I:!; 9!I:!;!9 IB%   $ >  > I: ; 9   : ;9  I !I/ 4: ;9 I .?: ;9 'I@z: ;9 I4: ;9 I Ib. d0/////0./1//0L/2f///////n. , /00///0////0.0/00/10//0L/0/2///////G. (/365//00////2/0////////301////3/1///3/3/ .1///////////0//2/5//3///1///1//50////2///0/.0//0/3///2////20/5/20//2////1/////2/////2//3/0///20/00/10//02//1///0//0//2/// .0//0//0/// .0/04//2/ .0/04//02/ .///0///0000/14/// .004/ .004/3/1/ ./1/0/0/0//////h. ZK///00g2///00g////2/00g//2/0/g//J. L/gK.   .// /export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc../.././gcclibgcc2.carm-isa.hlibgcc2.h10d,2/. /export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc../.././gcclibgcc2.carm-isa.hlibgcc2.h0J/ -./ /../ /../ ./-///. .  /export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc../.././gcclibgcc2.carm-isa.hlibgcc2.h/h -0 JL /export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc../.././gcclibgcc2.carm-isa.hlibgcc2.h2J3..2f  /export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc../.././gcclibgcc2.carm-isa.hlibgcc2.h.0 tJ /- / .0  .h / J  hJ J0-/I/1 L*.N g ..JM.2/.I//.J..2 /.q.. | d | , | @( H T @$ H J @( H L @,H \ H $@tt F D F j | 0ZJ FB J FJ F FF L | 0<TH | \D | ( | 0d | ,L | @ | B/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/config/arm/lib1funcs.S/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/build/build-cc-gcc-final/arm-muntsos-linux-gnueabihf/libgccGNU AS 2.45__udivsi3__aeabi_uidivmod__divsi3__aeabi_idivmod/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/config/arm/ieee754-df.S__subdf3__aeabi_dsub__adddf3__aeabi_dadd__floatunsidf__aeabi_ui2d__floatsidf__aeabi_i2d__extendsfdf2__aeabi_f2d__floatundidf__aeabi_ul2d__floatdidf__aeabi_l2d/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/config/arm/bpabi.S__aeabi_ldiv0__aeabi_idiv0wordisa_bit_predresisa_bit_vfp_baseGNU C23 15.2.0 -mcpu=arm1176jzf-s -mfloat-abi=hard -mfpu=vfpv2 -mtls-dialect=gnu -marm -march=armv6kz+fp -g -g -g -g -g -O2 -Os -O2 -O2 -Os -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fvisibility=hiddenisa_nobitisa_bit_mve_floatshort intisa_bit_secisa_bit_sbDWunionisa_bit_iwmmxt2isa_bit_quirk_no_volatile_ceisa_bit_mpisa_bit_armv5tisa_bit_armv5teisa_bit_neonisa_bit_bf16fbit_implication/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/libgcc2.cisa_bit_cryptoisa_bit_tdivconsisa_bit_iwmmxtlong long intisa_bit_armv6isa_bit_mveisa_bit_cdecp0isa_bit_cdecp1highisa_bit_cdecp3isa_bit_cdecp4isa_bit_fp_dblisa_bit_cdecp6isa_bit_cdecp7complex floatisa_bit_armv6kisa_bit_armv8_1m_mainanteisa_bit_cmselong doubleunsigned charisa_bit_fpv5isa_bit_xscaleUSItypelong long unsigned intisa_bit_quirk_cm3_ldrdDWstructisa_bit_i8mmshort unsigned intisa_bit_fp_d32UDItypeisa_bit_armv7emisa_bit_lpaeisa_bit_fp16all_implied_fbitsisa_bit_armv8_1isa_bit_armv8_2isa_bit_armv8_3isa_bit_armv8_4isa_bit_armv8_5isa_bit_armv8_6isa_num_bitsisa_bit_smallmulcomplex doubleisa_bit_pacbtiisa_bit_cdecp2__ctzdi2isa_bit_quirk_vlldmisa_bit_cdecp5isa_bit_vfpv2isa_bit_vfpv3isa_bit_thumbisa_bit_fp16convisa_featureisa_bit_notmisa_bit_quirk_armv6kzisa_bit_crc32isa_bit_adivisa_bit_quirk_no_asmcpuisa_bit_vfpv4isa_bit_armv4isa_bit_thumb2isa_bit_be8isa_bit_armv7isa_bit_armv8isa_bit_armv9isa_bit_fp16fmlisa_bit_quirk_aes_1742098isa_bit_dotprod__popcountdi2__fixdfdi__fixunsdfdiDFtype__aeabi_d2ulzGNU C23 15.2.0 -mcpu=arm1176jzf-s -mfloat-abi=hard -mfpu=vfpv2 -mtls-dialect=gnu -marm -march=armv6kz+fp -g -g -g -g -g -O2 -Os -O2 -O2 -Os -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fexceptions -fvisibility=hidden__udivmoddi4/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/build/build-cc-gcc-final/arm-muntsos-linux-gnueabihf/libgcc/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/config/armlib1funcs.Sieee754-df.Sbpabi.SBPQ(+Q (S $P7 PQ d+ P$8S@@S@D p s"DH3q 3333q2% 3333"q 3333q2% 3333"4%" s"HLPLd3q 3333q2% 3333"q 3333q2% 3333"4%" s"0Q0<P<@q 3333q2% 3333"@D p DHPHd0q 3333q2% 3333"q 3333q2% 3333"4%" 9PQ+PQ,+m(PQ(@+@N(+N2++A2(@+N2++A2IPQ+`RS`+ PQPQPQPQP^|\^\^\^\^PRS`RSRSRSDhQXxXXHTw T` -PJMNw (    t |      T      $  "  -    ? d UT  a T x xl    H   ` P  T          ( ا    X `     X    \ d bdX   H     0 ( 4  /̶ 6̶   A T \  ȹ   S  \ jx Х x  ( (    t | |H h   L P  $    D H H, d t t\ 7 |  < ` JL ]L d i   x     T 8 H     D H H  ( (   P  | +| ; P Rd   d p }       D   ,       X  $  H H L $  ( (      *D   9   R   e ( , p,   zd <    ! ! ! " " "  # $# $#  $ $ $( ) <) <) . . ., 2 (2 (2 6 $6 $6 *6( 7 7 : : `; p; H< X< 0= @= > > ?  ? ?  :  H   Y? d?X s(@P x@ B B  E E dF hF F F LG PG G G DH LH H H I I U HU V V \W `W X X Z Z @[ D[ [ [ L\ T\ \ \ D] H] ] ]  `  `  8` l @` @`` a a aL a b d d 4f Hf (h 8h pj j m m 4r Dr t  t S | | $} 0} #0} } } 2} ؀ ܀ C܀   ` p      Z m(   w$ $ , , 4  8  Љ Љ X l l         @ Ȏ ܎ ܎ tX ؐ  p d h ̗  &  8 KX \@ j( w0 0l     l  (  ̚ ̚ 1L <  ܝ ܝ   l Į  h  0 4   Ը  ̹ Թ ĺ ̺    h p 1p< I `      ^  M t  X l  u       ( 4 T        t         ( (    ! -  9  x   L p   a      H L  $   $ p v p  < <X  ,    | |@   ` p      4  4  $ 4 $    L  p  f                x      @ D   h l     X x D D  \  @ H  H   h   H ` < H   ,   x   L -    @  x    M  ,  @  [ @ X     h      x           4 ]P   L 8 L LX           w P X X     X Xd    |    &  \'\ \' ' ' @* X* `7 7 8 l  l 8% 8 8 8 $9 ,9 ; ; 8> D>    ? . ? 5 ? $5? ? ? L ?  a @8 B B dC lC dD pD E E tE |E E E F F hG lG K K L L PN TN (O 4O O O P P  Q $Q xQ |Q X z X  \   dR S (S xS S S    t S U ,U V V W W W W X X X t   X X ` ` `h 0a @a` @a a a a  b ,b  ,b b b  b ,d x  x   , @ E@   U@ 4  <  d< p      r T     }       d 0  4  4 8 h  l  l D      X     T   $ $  4 4 $   1 @Ld L   O   `h   ( {(   T   h | | DP     ! & l' t' t'0 ) ) )  84  0 0 $4 7 7 $> ,> @ '@ -@ :@ H@ A A 0B  T_8B f8B w@Bx B D D D E E E TF XF XF tFp F8 G G G G G G G  )H  ; H IH \J dJ YdJ| jJ` 8K @K y@Kl K t K K L L L  LH M M M M M M N N Nt N hP lP lP( Qt R R R R R .R ;T8 (V ,V I,V bY Y Y ^ ^ p^L _ _ _ g g h h hp i i i i \j dj j j k k l l Tn ln n o to |o r r t t \u du u u { l| }        ,0 0 @ BL H P} }T  < \ \  |l H 0 H4 t &L [ X    H L   H \ Й ԙ  ( \ `   Ě К  .  5 <$    K ( 8 X4 Л ԛ jԛ ̜ М tМ ` h h@   @     Ȟ Ȟ ( h hX        X X \ ܱ D  D  p ( (, T 3h I( K g@  ,    L P t  h l          y` , 8 |    $      ` |   $ <   0 0( D X    P8 p     , D     ( 0    ( 8         d  ( , @ @`          # H+H  6H  H`  t ]x \   q<      H        ( , x |     t  8,  $ (% % % & ' \' + +@ 0 D0 !   < Ф 0 < < T3 (" P6 X6 7 8 d: h: ; ;T << x" D< /D<8 l? |? :|?L ? ? I?D @  @ Z @` h@ l@ ol@8 @ @ |@ A A Ah B B B B B B  C C C TD `D `D D E E` lE pE pE  F F F  H hP  $I $I I I /It XK pK ApK N 8O I8O0 dP hP Y Z eZ` \[  u $~ x[ x[ _ # _ _$ a  b  b xd d dt l $m m m ,o 0o p p hq lq q q r t  X ? t t wt 8% hv w x x y y y< {  { `| t| | | ~ ~ l l$   !@ Ȁ Ѐ 0Ѐ( 4& @t h l MlD   W   Ȏ _Ȏ   u4 Џt D  Д Д(     @ *   4 H H ؝  ` d   d l $ , p | P Pd   *d   :@@ p  E X  k {   ة       H h *  h < d  d   )   ص 4 ص  @ ( K 4 4 @ W @|   c й  ̼ Խ  ܾ     d l n Pt H P        X `     0       < L \ t      8 , d , , ,            0 !0  h        t h !l !l\ %! 6!$  F!| $ 4 L \ l x N! l t   0   V! \!$   j!t ` h x!h( p0 !H   ! !D   !   !   !   !     ! p 8  D  "D  #" \ 0   5"x <"x$   K"  \1 _" , < j"<D x  {"d   "d D H "H8 |  "   "h   "   "\   " #  # x  '#0 3#(   I# L   (! 0! X#0! " " w#" " " #"  # # ##4 |& & #& ( ( #(  ' 2 ,3 #,3$ <4 P4 #P4  = 0> #0> ?   $ , $ 4$< $!$@ <@ .$@@ 6$@@ @ @ K$@P  A A b$A A A z$Ax 4 $B B B $B C C $Cx D lS `T XY $ $  $$$\Y l= PZ %TZ H\ L\ \ \ ] ]  %    %] ^  ^  ^ $^ d^ h^ ^ ^  "%  -%  8%8_ _ _ _ ` t` A%` L%= a  e Pg $h dh h h j $k l W%f%O l o%l  l $l {%$lH dl ll %ll m m %m v v %v w x %x x x %xP y z %zt H} t} %t} ˱    % %X P& &T Ԍ ܌ &܌(  %&x \ | 7&| 8 \ ?&\ ܒ  S& Ԗ  [& x  o& ` t |&t   &   &d    &,  < &<   &D  @ &@x &   'dW  '       į   ȱ б   P \ \ x ' p |   $' P \ @ H   0' t | l t >'P K'Px     _'X 8 X e'\  8Y  m'   y'   '$  $ '$   '     8        '      D H        '   ' ' ' p ` x 'x $! 0! (0! " " (" P) x) l* p* (p*4 49 9 : : : : : : 0; 8; L= X= G lH " lU 3(U =(U a V V hW ` Q(` ,W( Pd( 4L L lr( \X (X (W (W (W (W, W W (W  (W@ X  X ( X (X  ,X b 0X (0XT pY Y )Y4 [ [ )[\ \ ] )] Pa a 0)a b b E)b (d 8d X)8d u)d| @f Lf )Lf g g )g |k k )k n 4o )4o$ u Xv )XvH |x x z z ~ ~ 4 h   ` h    ) ,P )P )Ȍ   ) p L   ) \ h d *d@   (*@   lT  8 `  h    ̧ A*O*W*e*$ r d | h | ԰  ( в q*в  *ز  **t 0 ȱ ر < ***H *H@  t    p t    *** *t (  ж      $ ط ܷ   *  ++*+ 4+  t H+   Y+ k+ +   +L \ d +d +l, ̾  + +    +4 ,d ,8 , T X   ., d  G, V, \ h,h  ( ,(p ,   , ,,0 ,\   ,   , ,$   ,   -   -   $-   4-   >- d  H-   \- X  j- @ D v-D   |  -t  t -t $ ( f    T \ -\0 @    D  -, 2  ----L2 -L2 \3 d3 .d3X *.3, @.3 P.4 4 4 X.4( 7 2 7 q.7 <9 x9 .x9$ : : .: h; l; .l;\ ; ; .; < < .<t L= T= .T= = = .= t> |> .|>p > > />| `? h? /h?h ? ? 5/?h 0@ 8@ F/8@h @ @ V/@p A A t/A B B /B HC XC /XC C C /C H H H H I  I  >| ?> O>0 e> ~>$ > >N >L\ >\Y >XH >|h ?p #? 0?  >?X XO?  d?r0 }?Uh ?H( ?L ? ?O ?Jh ?A ?tt @ @x -@ ?@   Y@D n@ @$ A @H @TRT @f @, @\ @ @D A( A( $A(D 5Aj KAW8 ]AxP qA A XA4 A| AĽ AA Ad A@= B3 B{ /B IB \ZBرp B< BT XB <B} B0J$ B4 B,4 CdX Cp  &CD  6C8p OCLh gCl ~C C C` C$( C4 C(z  C: D D, D  7Dh NDd bD uDP D5 DJ( D D0 D|8 DI< DȇD E`u E؞ *Ep ;E|8D MEW \Eh:< lErx |E EQp E: E@ E E( EP <E  F  %Fp} ;F-X NF~ \FAT kF FLH F FA FwT F F$ F\'< G G0A 2G<5l EGC OGI bGX mG {G7 G G] G` G  G G G0 GM  H, H', /H  BH LH XaH( jHl6p |H HP Hhv  H$ HDr HR I IH@ -Itp EI^ XIоx gIT( zIe IDv$ I  I$^D I Il Ih` Ix J JP 'Jx >J LJ4 UJ hJFh zJ <J J@ JX J<9 Jd JX\ KX KN@ /K` ;K@X FK7x RK: bK( ~K $ K_t K̹ Kl Kx\ K K,R0 L4 L$L 5L NL0 dLD qL$ L4r0 L: L   L`, LMT L( L< MlD ,MTX @ %Y< EY ]Y vYz Yi Y\ Y$X Y Y Y44$ Yh Z;H Zp\ ,Z X>Zh ZZpr4 jZ <|Z` Z, ZXf Z ZT? ZT9 Z>H [YX $[ :[ Q[HUD j[X |[d [( [l [t [t [ [d \p ,\̏, G\D^x d\P x\|4 \P \ ]| ] X^X ^( 2^ ?^ x S^@ g^  ^( ^Թ ^h^H ^ ^8  ^ ^("X ^ X _5 !_ 0_  @_ U_4 i_|B {_h _( _l| _ _, _d8 _q `hF ` F$ 6`@ U`P k`^p `8 `D `L `d( `|@ ` `,K a <aL 0aD Ga$Z _a06P pap, a8, aX6h ak  RkH ak\ rkH, kpLX k <k`h kt kp| kHf l H lD 4l,>t ?lWX Zl8 hl slG` l ll lx lBP l(D l l\t m6 m$ 9mP Km \mPl jm` ~mM m  m< mYx m8 m md nh4 nlxl +nt Cn Xn cn  yn 5 n0 npH nT nJ( n| nD ny og  &o$ 9o8  Po uohD o4| ot o o o o pddP p(   0p  @p, RpH] jp yp pd pX pt p? p0 pd p@yP q0 %q4 Dqt NqD dqL xq qG qm\ q4x q qT@ q rl 8rtT Hr dr< xrN\ r r  r\_\ rLHp r rl s  #s\ 8s Is` <ZsMH ns$ s sp sl| s  s( sb  sL t t(t /tx Dtk Xt`WP ptv$QX OjБ4 8Ii, |Β.(8 <VyדX ,W  60X Jh0 \{̔ޔ/Xwx `< ֕/U <Ruۖdh l  t #Ng v× '8Wg| ј   p >Xhox Ùԙ%CBp TfĚ(SX ۚL ;Y{›ę=OoD\  ̜ /К >QbPg Ɲ&  :Ps՞ &(Ha;pD ֟dR |E| "BStР:Mc|ȡln &Mq΢ 0Rqۣ`|  OduŤEl ("AYwH $p |Q ʥ;[crti.o$acall_weak_fn$dcrtn.ocrtstuff.call_implied_fbits__do_global_dtors_auxcompleted.0__do_global_dtors_aux_fini_array_entryaltsvc.chostcomparealtsvc_flushaltsvc_createidaltsvc_add.isra.0amigaos.casyn-ares.casyn-base.casyn-thrdd.caddr_ctx_unlinkgetaddrinfo_threadasyn_thrdd_awaitbufq.cprune_headget_non_full_tailbufref.ccf-h1-proxy.ccf_h1_proxy_adjust_pollseth1_tunnel_go_statecf_h1_proxy_closetunnel_freecf_h1_proxy_connectcf_h1_proxy_destroycf-h2-proxy.ccf-haproxy.ccf_haproxy_closecf_haproxy_connectcf_haproxy_adjust_pollsetcf_haproxy_destroycf-https-connect.ccf_hc_cntrlcf_hc_shutdowncf_hc_adjust_pollsetcf_hc_data_pendingcf_get_max_baller_time.isra.0cf_hc_querycf_hc_reset.isra.0cf_hc_destroycf_hc_closeballer_connected.isra.0cf_hc_connectcf-ip-happy.ccf_ai_iter_nextcf_ip_ballers_max_timecf_ip_happy_querycf_ip_happy_data_pendingcf_ip_happy_adjust_pollsetcf_ip_happy_shutdowncf_ip_happy_closecf_ip_happy_destroycf_ip_happy_connectcf-socket.ccf_socket_querycf_socket_conn_is_alivecf_socket_recvcf_socket_sendcf_socket_adjust_pollsetcf_socket_shutdowntcpnodelaybindlocalverifyconnectcf_socket_closecf_socket_destroysocket_connect_resultset_local_ip.isra.0cf_tcp_accept_connectcf_socket_opencf_udp_connectcf_tcp_connectcf_socket_ctx_initcf_socket_cntrlhost_prefix.1if_host_prefix.0cfilters.ccf_bufq_writercf_bufq_readerconn_report_connect_stats.isra.0conncache.ccpool_bundle_free_entrycpool_discard_conncpool_get_firstcpool_get_oldest_idlecpool_remove_conncf_setup_destroycf_setup_closecf_setup_connectcf_setup_create.isra.0content_encoding.czalloc_cbzfree_cberror_do_initerror_do_closedeflate_do_initgzip_do_initdeflate_do_closegzip_do_closeprocess_trailerinflate_streamgzip_do_writedeflate_do_writeerror_do_writeidentity_encodinggeneral_unencodersdeflate_encodinggzip_encodingerror_writercookie.cfreecookiecookie_sort_ctcookie_sortsanitize_cookie_pathcookie_tailmatchget_netscape_formatcookiehashCurl_cookie_clearall.part.0cshutdn.ccshutdn_run_conn_handler.part.0cshutdn_run_once.part.0sigpipe_apply.part.0cshutdn_destroy_oldestcurl_addrinfo.ccurl_des.ccurl_endian.ccurl_fnmatch.ccurl_get_line.ccurl_gethostname.ccurl_gssapi.ccurl_memrchr.ccurl_ntlm_core.csetup_des_keymagic.0curl_range.ccurl_rtmp.ccurl_sasl.cget_server_messagesasl_unchosen.part.0build_message.isra.0mechtablecurl_sha512_256.cCurl_sha512_256_initCurl_sha512_256_update_iCurl_sha512_256_finish_vcurl_sspi.ccurl_threads.ccurl_thread_create_thunkcurl_trc.ctrc_apply_level_by_categorytrc_apply_level_by_nametrc_print_ids.constprop.0trc_write.part.0.constprop.0trc_infofs_infotype.0s_infotype.1Curl_trc_feat_idstrc_cftstrc_featsCurl_trc_timer_namesCurl_trc_mstate_namescw-out.ccw_out_initcw_out_cb_writecw_out_ptr_flushcw_out_flush_chaincw_out_flushcw_out_appendcw_out_closecw_out_do_writecw_out_writecw-pause.ccw_pause_initcw_pause_writecw_pause_closedict.cunescape_worddict_dodoh.cdoh_probe_write_cbdoh_probe_donedoh_probe_rundoh_probe_dtorerrorsdynhds.ceasy.cdupeasy_meta_freeentryCurl_senddata.part.0easy_perform.constprop.0initializeds_lockeasygetopt.ceasyoptions.cescape.cfake_addrinfo.cfile.cfile_dofile_setup_connectionfile_easy_dtorfile_disconnectfile_donefile_connectaccept_ranges.0fileinfo.cfopen.cformdata.cfseeko_wrappersetnameCurl_getformdata.part.0free_chaincurl_formfree.localaliasfreedirsftp_easy_dtor_ftp_stateftp_domore_pollsetclose_secondarysocketftp_pp_statemachineftp_endofrespftp_state_retrftp_state_use_pasvftp_epsv_disableftp_state_ul_setupftp_state_listftp_state_use_portftp_initiate_transferftp_cw_lc_writewc_data_dtorftp_parse_url_pathcontrol_address_dupftp_state_pasv_respftp_disconnectftp_state_sizeftp_state_prepare_transferftp_state_type_respftp_state_quoteftp_nb_typeftp_state_typeftp_state_mdtmftp_state_loggedinftp_check_ctrl_on_data_waitftp_do_moremode.1mode.2nl.0ftp_cw_lcftp_state_namesftpauthftplistparser.cfileinfo_dtorftp_pl_insert_finfo.isra.0getenv.cgetinfo.cgopher.cgopher_connectgopher_dogopher_connectingheaders.chds_cw_collect_writehds_cw_collecthmac.chmac_ipadhmac_opadhostip.cdnscache_entry_is_stalednscache_entry_dtorshow_resolve_infofetch_addrdnscache_add_addrstore_negative_resolve.isra.0hostip4.chostip6.chsts.chsts_createhsts_pullhsts_add.isra.0hsts_loadhttp.cpickoneauthhttp_switch_to_getauthcmpcr_exp100_donehttp_should_failcr_exp100_readhttp_perhapsrewind.isra.0http_exp100_send_anywayhttp_exp100_got100checkhttpprefix.isra.0output_auth_headershttp_write_headerhttp_rw_hdcr_exp100H2_NON_FIELDhttp1.cstart_reqhttp2.chttp_aws_sigv4.ccompare_header_namescompare_funchttp_aws_decode_encodecanon_querycalc_payload_hashhttp_chunks.ccr_chunked_total_lengthcw_chunked_initcw_chunked_closehttpchunk_readwritecw_chunked_writecr_chunked_closecr_chunked_initadd_chunkcr_chunked_readhttp_digest.chttp_negotiate.chttp_ntlm.chttp_proxy.chttp_proxy_cf_destroyhttp_proxy_cf_closehttp_proxy_cf_connecthttpsrr.cidn.cif2ip.cCurl_ipv6_scope.part.0imap.cimap_easy_resetimap_easy_dtorimap_is_bcharimap_sendfimap_disconnectimap_multi_statemachimap_pollsetimap_cancel_authenticateimap_perform_fetchimap_matchrespimap_atomimap_perform_listimap_setup_connectionimap_pp_statemachineimap_endofrespimap_conn_dtorimap_get_messageimap_continue_authenticateimap_perform_authenticateimap_perform_login.part.0imap_perform_authenticationimap_doneimap_doingimap_connectimap_dosaslimapkrb5.cllist.cmacos.cmd4.cmy_md4_bodymd5.cmy_md5_finalmy_md5_updatemy_md5_initmemdebug.cmime.cencoder_nop_sizeencoder_7bit_readencoder_base64_readencoder_base64_sizeqp_lookahead_eolencoder_qp_sizemime_mem_seekmime_mem_freemime_part_rewindcr_mime_needs_rewindcr_mime_total_lengthcr_mime_is_pausedmime_mem_readencoder_qp_readencoder_nop_readmime_file_freecontent_type_matchescape_stringcr_mime_closecr_mime_initmime_file_readmime_file_seeksearch_headermime_sizemime_subparts_seekmime_subparts_unbindCurl_mime_cleanpart.part.0mime_unpausecr_mime_cntrlread_part_content.part.0readback_partcr_mime_resume_fromcr_mime_readmime_subparts_freeqp_classaschexcr_mimeformtable.1mimetable.0ctts.2mprintf.cout_numberstorebufferdollarstringalloc_addbyterfputc_wrapperformatfnilstrmqtt.cmqtt_conn_dtormqtt_pollsetmqtt_recv_atleastmqtt_sendmqtt_get_topicmqtt_donemqtt_easy_dtormqtt_setup_connmqtt_domqtt_read_publishmqtt_doingmulti.cph_freeentrymulti_xfer_bufs_freemstateinit_completedbefore_performclose_connect_onlyadd_next_timeout.isra.0multi_mark_expired_as_dirtymulti_done_lockedmspeed_checkmulti_timeout.isra.0process_pending_handlesmulti_donemulti_handle_timeoutmulti_wait.part.0multi_runsinglemulti_run_dirtymulti_socket.isra.0tv_zero.0finit.1multi_ev.cmev_sh_entry_hashmev_sh_entry_comparemev_sh_entry_updatemev_sh_entry_dtormev_forget_socketmev_pollset_dtormev_assess.part.0netrc.cnoproxy.copenldap.cparsedate.cparsedatetzmonth_days_cumulative.0weekdaypingpong.cpop3.cpop3_easy_dtorpop3_writepop3_conn_dtorpop3_cancel_authpop3_multi_statemachpop3_pollsetpop3_get_messagepop3_continue_authpop3_perform_authpop3_endofresppop3_donepop3_setup_connectionpop3_doingpop3_perform_capapop3_connectpop3_statemachinepop3_perform_userpop3_perform_apoppop3_dopop3_perform_authenticationpop3_disconnectsaslpop3pop3cmdsprogress.cprogress_calctime2strmax5datapgrsupdatepsl.crand.crename.crequest.creq_set_upload_donereq_flushadd_from_clientrtsp.crtsp_easy_dtorrtsp_conn_dtorrtsp_do_pollsetrtsp_connectrtsp_donertsp_dortsp_setup_connectionrtsp_conncheckrtp_write_body_junkrtsp_filter_rtprtsp_rtp_write_resprtsp_rtp_write_resp_hdselect.cCurl_pollset_change.part.0cpfds_increase.constprop.0sendf.ccl_reset_writercl_reset_readercr_in_initcr_in_needs_rewindcr_in_total_lengthcr_in_is_pausedcr_lc_total_lengthcr_null_readcr_null_total_lengthcr_buf_needs_rewindcr_buf_cntrlcr_buf_total_lengthcr_buf_resume_fromcw_raw_writecw_download_writecr_in_resume_fromcr_in_readcr_lc_closecr_lc_initcr_buf_readcr_in_cntrlcr_lc_readdo_init_writer_stack.part.0do_init_reader_stackcw_downloadcw_rawcr_lccr_incr_nullcr_bufsetopt.cprotocol2numsetstropt_userpwd.constprop.0setopt_cptrsha256.cmy_sha256_initmy_sha256_updatemy_sha256_finalshare.cslist.csmb.csmb_easy_dtorsmb_conn_dtorsmb_pollsetsmb_dosmb_send_and_recvsmb_connectsmb_setup_connectionsmb_send_messagesmb_send_tree_connectsmb_send_setupsmb_connection_statesmb_send_open.constprop.0smb_request_statesmtp.csmtp_easy_dtorcr_eob_total_lengthsmtp_statesmtp_cancel_authsmtp_disconnectsmtp_multi_statemachsmtp_pollsetsmtp_get_messagesmtp_continue_authsmtp_perform_authsmtp_endofrespsmtp_perform_authenticationcr_eob_closecr_eob_readcr_eob_initsmtp_setup_connectionsmtp_conn_dtorsmtp_parse_address.constprop.0smtp_parse_url_path.isra.0smtp_perform_rcpt_to.isra.0smtp_perform_command.isra.0smtp_donesmtp_pp_statemachinesmtp_doingsmtp_dosmtp_connectcr_eobnames.0saslsmtpsocketpair.csocks.csocks_proxy_cf_closesocks_proxy_cf_destroysocks_cf_adjust_pollsetsocks_cf_querysocks_state_recv.isra.0socks_state_send.isra.0socks_proxy_cf_connectlookup.0socks_gssapi.csocks_sspi.cspeedcheck.csplay.cSPLAY_SUBNODEstrcase.ctouppermaptolowermapstrdup.cstrequal.cstrerror.csystem_win32.ctelnet.ctelnet_donetelnet_easy_dtorsend_telnet_dataprintsub.part.0printoption.part.0send_negotiationsendsuboptiontelnet_dotelnetoptionstelnetcmdstftp.ctftp_conn_dtortftp_pollsettftp_set_timeoutstftp_rxtftp_connect_for_rxtftp_txtftp_connect_for_txtftp_connecttftp_setup_connectiontftp_translate_code.part.0tftp_donetftp_send_firsttftp_state_machinetftp_multi_statemachtftp_doingtftp_dotransfer.cxfer_setupuint-bset.cuint-hash.cuint-spbset.cuint-table.cuint_tbl_clear_rowsurl.cup_freesetup_rangezonefrom_urlparse_proxyurl_match_resultconn_meta_freeentryurl_match_connCSWTCH.310protocols.0urlapi.cfree_urlhandleipv6_parseurlencode_strparse_authorityparseurl_and_replaceversion.chttps_proxy_presentout.1ssl_buffer.0feature_namessupported_protocolsfeatures_tablews.ccr_ws_initcr_ws_closews_cw_initws_cw_closews_conn_dtornw_in_recvws_setup_connws_send_raw_blocking.isra.0ws_flushws_enc_infows_enc_add_framews_enc_write_payloadws_enc_add_pendingws_enc_add_cntrl.constprop.0ws_client_collectws_cw_dec_nextcr_ws_readws_dec_infows_dec_passws_cw_writews_cr_encodews_cw_decodecleartext.ccram.cauth_digest_string_quotedauth_digest_sha256_to_asciiauth_digest_md5_to_asciidigest_sspi.cgsasl.ckrb5_gssapi.ckrb5_sspi.ctype2_marker.1host.0ntlm_sspi.coauth2.cspnego_gssapi.cspnego_sspi.cvauth.cntlm_conn_dtorcipher_suite.cgtls.chostcheck.ckeylog.ckeylog_file_fpmbedtls.cmbedtls_threadlock.copenssl.cossl_bio_cf_destroySSL_ERROR_to_strossl_data_pendingossl_cert_status_requestossl_get_internalsoss_x509_share_freeossl_keylog_callbackossl_tracepasswd_callbackossl_provider_cleanupossl_close_allssl_ui_writerssl_ui_readerx509_name_onelineossl_get_channel_bindingossl_sha256sumossl_engines_listossl_set_engine_defaultossl_closeossl_on_session_reuseossl_bio_cf_createossl_bio_cf_ctrlossl_bio_cf_out_writeossl_cleanupossl_initossl_do_file_typeossl_strerrorossl_set_providerossl_set_engineossl_sendossl_recvossl_send_earlydataossl_shutdownossl_randompubkey_show.isra.0ossl_new_session_cbossl_bio_cf_in_readossl_connect_step2ossl_connectrustls.cschannel.cschannel_verify.cvtls.cfree_primary_ssl_configssl_cf_data_pendingssl_cf_adjust_pollsetcf_ssl_is_aliveblobdupclone_ssl_primary_configmultissl_versionssl_cf_shutdownssl_cf_cntrlcf_ctx_freemultissl_setup.part.0multissl_initmultissl_send_plainmultissl_recv_plainmultissl_closemultissl_get_internalsmultissl_adjust_pollsetmultissl_connectmultissl_randomCurl_ssl_free_certinfo.part.0ssl_cf_querycf_ctx_new.isra.0cf_ssl_create.isra.0match_ssl_primary_config.isra.0ssl_cf_closessl_cf_destroyssl_cf_connectssl_cf_connect_deferred.constprop.0ssl_cf_sendssl_cf_recvALPN_SPEC_H11backends.1selected.2backends_len.0init_sslavailable_backendsCurl_ssl_multivtls_scache.ccf_ssl_scache_session_ldestroycf_ssl_scache_clear_peercf_ssl_peer_key_add_pathcf_ssl_peer_key_add_hashcf_ssl_scache_getcf_ssl_cache_peer_updatecf_ssl_scache_match_authcf_ssl_find_peer_by_key.part.0.constprop.0cf_ssl_add_peercf_scache_peer_remove_expiredvtls_spack.cwolfssl.cx509asn1.ccurl_ngtcp2.ccurl_osslq.ccurl_quiche.cvquic.cvquic-tls.clibssh.clibssh2.ccurl_path.cwolfssh.cbase64.cdecodetablebase64urldynbuf.cdyn_nappendinet_ntop.cinet_pton.cmultibyte.cnonblock.cstrparse.cstr_num_basetimediff.ctimeval.cversion_win32.cwait.cwarnless.cwinapi.c_udivsi3.o.udivsi3_skip_div0_test_divsi3.o.divsi3_skip_div0_test_arm_addsubdf3.o_aeabi_ldivmod.o_aeabi_uldivmod.o_dvmd_lnx.olibgcc2.c__FRAME_END__curlx_dyn_freeCurl_cft_sslcurlx_timediffCurl_ssl_scache_remove_allCurl_cft_h1_proxyCurl_pgrsUpdate_nometerCurl_raw_tolowerCurl_conn_get_alpn_negotiatedCurl_conn_keep_aliveCurl_sasl_decode_mechCurl_ntlm_core_mk_nt_hashCurl_cf_def_queryCurl_pretransferCurl_ftp_parselist_geterrorCurl_alpn2alpnidCurl_strerrorCurl_dynhds_set_optscurlx_str_cspnCurl_input_ntlmCurl_share_lockCurl_trc_cf_infofCurl_async_global_initCurl_conn_http_versioncurlx_str_assignCurl_tls_keylog_writeCurl_req_sendbuf_emptyCurl_share_unlockCurl_host_is_ipnumCurl_conn_shutdownCurl_dynhds_resetCurl_sasl_parse_url_auth_optionCurl_alpn_copyCurl_multi_handleCurl_uint_tbl_containsCurl_auth_decode_ntlm_type2_messageCurl_ssl_conn_config_matchCurl_ssl_backendCurl_hash_pickCurl_hash_add2Curl_multiplex_wantedCurl_netrc_cleanupCurl_cshutdn_terminateCurl_cf_ssl_insert_afterCurl_thread_joinCurl_ssl_easy_config_completeCurl_pollfds_resetCurl_ws_requestCurl_splaysetCurl_bufref_freeCurl_getinfoCurl_trc_smtpCurl_output_aws_sigv4Curl_llist_appendcurlx_dyn_vprintf__aeabi_ui2dCurl_creader_total_lengthCurl_uint_spbset_nextcurlx_dyn_addCurl_parsenetrcCurl_trc_multi_timeoutscurlx_str_numberCurl_conn_meta_setCurl_memdup0Curl_pollset_initCurl_gmtimeCurl_connect_only_attachCurl_pollset_changeCurl_pollset_checkCurl_alpn_restrict_tocurlx_nowftp_conns_matchCurl_ccallocCurl_dynhds_h1_add_linecurlx_uztouiCurl_pgrsDonecurlx_ultoucCurl_auth_allowed_to_hostCurl_ssl_session_createcurlx_str_initCurl_gethostnameCurl_conn_cf_get_alpn_negotiatedCurl_creader_set_bufCurl_uint_hash_visitCurl_conn_ev_data_idleCurl_pgrsStartNowcurlx_str_singlespacecurlx_str_singlecurlx_str_newlineCurl_dnscache_clearCurl_cpool_upkeepCurl_conn_cf_cntrlCurl_flush_cookiesCurl_async_global_cleanupCurl_bufref_initCurl_fnmatchCurl_creader_client_lengthcurlx_sltouiCurl_multi_connchangedCurl_handler_gopherCurl_async_get_implCurl_http_req_makeCurl_bufq_sipnCurl_pollfds_add_sockCurl_trc_feat_dnsCurl_conn_get_current_hostCurl_hsts_saveCurl_trc_mstate_nameCurl_ssl_supportsCurl_ipv6_scopeCurl_client_readCurl_pin_peer_pubkeyCurl_creader_get_by_typeCurl_hexbyteCurl_netrc_strerrorCurl_ssl_scache_createcurlx_uitousCurl_dnscache_addCurl_timestrcmpCurl_cwriter_get_by_nameCurl_uint_hash_countCurl_pgrsEarlyDataCurl_closeCurl_async_pollsetCurl_dnscache_destroyCurl_cf_def_data_pendingCurl_creader_freeCurl_ntlm_core_mk_ntlmv2_respCurl_ossl_ctx_initCurl_multi_mark_dirtyCurl_hash_start_iterateCurl_conn_sockindexCurl_auth_create_digest_md5_messageCurl_conn_ev_data_setupCurl_rand_hexCurl_http_proxy_get_destinationCurl_add_timeconditionCurl_cshutdn_add_waitfdsCurl_auth_create_ntlm_type1_message__aeabi_ldivmodCurl_shutdown_startedCurl_cshutdn_add_pollfdsCurl_tls_keylog_write_lineCurl_uint_bset_initCurl_conn_cf_adjust_pollsetCurl_splaygetbestCurl_speedinitCurl_ossl_versionCurl_infofCurl_pgrsSetDownloadCounterCurl_init_doCurl_hash_addCurl_handler_smbCurl_xfer_setup_recvCurl_pgrsSetDownloadSizeCurl_conn_cf_pollCurl_dohCurl_uint_bset_count__udivmoddi4Curl_conn_connectCurl_conn_is_sslCurl_cf_def_conn_keep_alive__aeabi_ul2dCurl_creallocCurl_xfer_send_is_pausedCurl_headers_initCurl_multi_ev_assess_connCurl_slist_duplicateCurl_client_resetCurl_base64encdeccurlx_dyn_ptrCurl_ssl_cleanupCurl_http_auth_actCurl_wildcard_initCurl_bufcp_initcurlx_dyn_initCurl_trc_ftp__floatsidfCurl_tls_keylog_openCurl_pollset_setCurl_http_output_authCurl_http_connectcurlx_str_numblanksCurl_h1_req_write_headCurl_handler_ftpsCurl_llist_initCurl_pollset_createCurl_uint_bset_resizeCurl_MD5_update__udivsi3Curl_conn_tcp_listen_setCurl_getdate_cappedCurl_ssl_scache_putCurl_ntlm_core_mk_lm_hashCurl_ssl_opensslCurl_auth_create_xoauth_bearer_messageCurl_creader_set_freadCurl_handler_wsCurl_cft_http_proxyCurl_req_send_moreCurl_conn_is_setupCurl_read16_leCurl_init_CONNECTCurl_fopenCurl_add_custom_headersCurl_hash_cleanCurl_cf_http_proxy_queryCurl_conn_get_transportCurl_setopt_SSLVERSIONCurl_rtsp_parseheaderCurl_shutdown_startcurlx_str_casecompareCurl_set_in_callbackCurl_bufq_write_passCurl_req_initCurl_cf_tcp_create__dso_handle__fixdfdiCurl_cwriter_def_closeCurl_httpchunk_is_doneCurl_cwriter_createCurl_ftp_parselistcurlx_sztosiCurl_node_take_elemCurl_ssl_set_engineCurl_trc_multi__subdf3Curl_multi_ev_conn_doneCurl_conn_cf_sendCurl_cf_setup_insert_afterCurl_http_methodCurl_socket_checkCurl_output_ntlmCurl_socket_closeCurl_hexencodeCurl_pp_pollsetCurl_rand_bytesCurl_multi_xfer_ulbuf_releaseCurl_meta_setCurl_url_set_authority__fixunsdfdiCurl_cf_https_setupCurl_uint_tbl_getCurl_cft_udpcurlx_dyn_vaddfCurl_uint_spbset_initCurl_req_done_sendingCurl_dnscache_initCurl_req_sendCurl_MD5_finalCurl_multi_ev_socket_doneCurl_uint_bset_containsCurl_creader_set_nullCurl_MD5_initCurl_cpool_get_connCurl_conn_may_http3__floatunsidfCurl_check_noproxyCurl_auth_ntlm_getCurl_cf_def_shutdownCurl_once_resolvedCurl_hstsCurl_conn_cf_closeCurl_wkdayCurl_trc_readCurl_socket_openCurl_cwriter_def_initCurl_raw_touppercurlx_sitouzCurl_udigitsCurl_cookie_clearsessCurl_bufq_readcurlx_sltosiCurl_hsts_loadfile__aeabi_idivCurl_netrc_initCurl_output_digestCurl_pollCurl_handler_gophers__ctzdi2Curl_resolv_checkCurl_HMAC_initCurl_uint_spbset_firstCurl_ssl_scache_unlockCurl_sasl_can_authenticateCurl_cpool_conn_now_idleCurl_init_sslset_nolockCurl_1st_fatalCurl_parse_login_detailsCurl_uint_spbset_removeCurl_http_neg_initCurl_bufq_skipCurl_ssl_peer_initCurl_alpn_set_negotiatedCurl_ssl_scache_lockCurl_ldigitsCurl_strntoupper_finiCurl_setup_connCurl_conncontrolCurl_trc_feat_smtpCurl_wildcard_dtorCurl_trc_feat_multiCurl_ntlm_core_lm_respCurl_get_line__adddf3Curl_thread_createCurl_cf_recv_bufqCurl_cft_http_connectCurl_cwt_pauseCurl_creader_doneCurl_trc_feat_readCurl_dynhds_getnCurl_req_stop_send_recvCurl_conn_cf_get_ip_infoCurl_creader_createCurl_http_setup_conn__floatdidfCurl_md5itCurl_resolvCurl_dynhds_addCurl_conn_shutdown_timeleftCurl_cw_out_is_pausedCurl_checkProxyheadersCurl_creader_def_closeCurl_pollset_cleanupcurlx_str_wordCurl_sasl_is_blockedCurl_meta_getCurl_conn_seems_deadCurl_h1_req_parse_freeCurl_httpchunk_unencodercurlx_str_key_comparecurlx_uztoszcurlx_dyn_setlenCurl_pgrsSetUploadSizeCurl_pp_needs_flushcurlx_dyn_resetCurl_xfer_write_resp_hdCurl_conn_data_pendingCurl_cwriter_writeCurl_auth_cleanup_ntlmCurl_xfer_is_too_fastCurl_alpnid2strCurl_parse_interfaceCurl_multi_pollsetCurl_mime_readCurl_ratelimitCurl_cshutdn_performCurl_meta_resetCurl_async_destroyCurl_alpn_contains_protoCurl_client_writeCurl_if2ipCurl_req_soft_resetCurl_pp_state_timeoutCurl_handler_rtspCurl_conn_freeCurl_ssl_cf_get_configCurl_setbloboptCurl_async_getaddrinfoCurl_cw_out_doneCurl_altsvc_initCurl_cf_def_adjust_pollsetCurl_handler_smbsCurl_cmallocCurl_ssl_cfilter_addCurl_sasl_continueCurl_ossl_add_sessionCurl_dynhds_countCurl_dnscache_pruneCurl_conn_flushCurl_http_write_resp_hdsCurl_http_decode_statusCurl_llist_destroyCurl_trc_init__divsi3curlx_tvtomsCurl_conn_get_ip_infoCurl_cshutdn_setfdsCurl_creader_will_rewindCurl_xfer_send_shutdowncurlx_str_untilnlCurl_tls_keylog_closeCurl_doh_is_resolvedCurl_vsetoptCurl_bufq_peekCurl_input_digestCurl_ssl_close_allCurl_ssl_session_destroyCurl_update_timerCurl_ossl_report_handshakeCurl_conn_cf_discard_sub__aeabi_dsubCurl_httpchunk_initcurlx_timediff_usCurl_conn_cf_connectCurl_req_abort_sendingCurl_cwriter_unpauseCurl_cookie_cleanupCurl_xfer_setup_sendCurl_hash_destroycurlx_dyn_lenCurl_handler_httpsCurl_xfer_setup_sendrecv__popcountdi2Curl_uint_spbset_countCurl_HMAC_finalCurl_HMAC_MD5Curl_trc_sslsCurl_conn_is_aliveCurl_sslCurl_auth_create_cram_md5_messagecurlx_mstotvCurl_memdupCurl_cf_recvCurl_doh_closeCurl_ftp_parselist_data_allocCurl_hash_initCurl_dnscache_mk_entryCurl_1st_errCurl_cft_ssl_proxyCurl_conn_cf_discard_chainCurl_handler_wssCurl_ssl_peer_cleanupCurl_creader_needs_rewindCurl_cft_setupCurl_hash_clean_with_criteriumcurlx_str_hexCurl_ssl_conn_config_initCurl_cf_def_conn_is_aliveCurl_xfer_setup_nopCurl_cpool_initCurl_mime_duppartCurl_easyoptsCurl_ossl_check_peer_certCurl_pgrsTimeWasCurl_pp_disconnectCurl_pollfds_add_psCurl_trc_feat_write__aeabi_idiv0Curl_sasl_startCurl_pgrsResetTransferSizesCurl_auth_user_contains_domain__extendsfdf2Curl_handler_imapsCurl_http_proxy_create_CONNECTCurl_ssl_session_create2Curl_http_resp_freeCurl_conn_ev_data_done_sendCurl_dynhds_cgetCurl_node_elemCurl_safereallocCurl_trc_feat_wsCurl_xfer_is_blockedCurl_uint_hash_removeCurl_handler_pop3sCurl_monthCurl_http_input_authCurl_ssl_cert_status_requestCurl_senddataCurl_getn_scheme_handlerCurl_ssl_cf_is_proxyCurl_cshutdn_dest_countCurl_bufref_ptrCurl_hsts_initcurlx_uztosiCurl_splayinsertCurl_creader_addCurl_auth_is_ntlm_supportedCurl_creader_def_total_lengthCurl_read32_leCurl_bufq_writeCurl_handler_dictCurl_get_scheme_handlerCurl_hash_deleteCurl_creader_readCurl_ipv6worksCurl_xfer_send_closeCurl_alpn_to_proto_strCurl_ssl_adjust_pollsetCurl_uint_hash_destroyCurl_compareheaderCurl_junkscanCurl_cshutdn_addCurl_cwriter_is_pausedCurl_uint_tbl_addCurl_http_followCurl_xfer_write_respCurl_conn_cf_recvCurl_handler_smtpsCurl_handler_telnetCurl_is_absolute_urlCurl_conn_setupCurl_bufq_init2_DYNAMICCurl_rand_alnumCurl_async_thrdd_shutdownCurl_http_req_freeCurl_conn_needs_flushCurl_dynhds_h1_cadd_lineCurl_multi_xfer_sockbuf_releaseCurl_creader_set_rewindCurl_auth_digest_cleanupCurl_ws_acceptCurl_mime_initpartcurlx_str_octalCurl_uint_spbset_destroyCurl_HMAC_SHA256Curl_cw_out_unpauseCurl_pp_statemachcurlx_nonblockCurl_pp_moredataCurl_thread_destroyCurl_handler_fileCurl_build_unencoding_stackCurl_pgrsUpdateCurl_cft_ip_happy__aeabi_l2dCurl_cshutdn_close_oldestCurl_copy_header_valueCurl_freesetCurl_resolv_blockingCurl_dynhds_getCurl_conn_is_tcp_listenCurl_cf_socks_proxy_insert_afterCurl_creader_def_initCurl_hash_next_elementCurl_conn_adjust_pollsetCurl_checkheadersCurl_ftp_parselist_data_freeCurl_auth_create_login_messageCurl_auth_build_spnCurl_renameCurl_http_write_respCurl_client_startCurl_multi_xfer_buf_borrowCurl_trc_feat_ftpCurl_all_content_encodingsCurl_conn_get_max_concurrentCurl_multi_get_easyCurl_cshutdn_destroyCurl_cookie_addCurl_ssl_init_certinfoCurl_multi_ev_initCurl_ssl_scache_destroyCurl_httpchunk_resetCurl_cwriter_is_content_decodingCurl_cookie_initCurl_http_do_pollsetCurl_splayCurl_pgrsLimitWaitTimeCurl_pp_readrespCurl_getaddrinfo_ex__aeabi_f2dCurl_cstrdupCurl_dnscache_getCurl_cw_pause_flushCurl_dynhds_h1_dprintCurl_multi_xfer_buf_releaseCurl_handler_imapCurl_xfer_pause_sendCurl_ssl_scache_get_objCurl_cwt_outCurl_http_req_to_h2Curl_cert_hostcheckCurl_tls_keylog_enabledcurlx_str_nudgeCurl_cookie_listCurl_strntolower__aeabi_uldivmodCurl_dynhds_initCurl_conn_upkeepCurl_printable_addressCurl_handler_pop3Curl_resolver_errorCurl_setstropt__aeabi_idivmodCurl_xfer_write_doneCurl_uint_bset_nextCurl_hsts_cleanupCurl_ssl_scache_returnCurl_h1_req_parse_initCurl_headers_cleanupCurl_HMAC_SHA512_256Curl_cshutdn_initCurl_cpool_destroyCurl_mime_set_subpartsCurl_cf_sendCurl_ssl_easy_config_initCurl_multi_ev_assess_xfer_bsetCurl_uint_bset_removeCurl_conn_get_stream_errorCurl_ntlm_core_mk_ntlmv2_hashCurl_read16_beCurl_sasl_initCurl_pollfds_initCurl_uint_bset_destroyCurl_trc_wsCurl_ssl_free_certinfoCurl_cft_tcpCurl_uint_bset_emptyCurl_uint_spbset_emptyCurl_conn_forget_socketCurl_node_removeCurl_bufq_is_emptyCurl_cwriter_def_writeCurl_pp_initCurl_conn_get_first_socketCurl_resolv_timeoutCurl_ssl_engines_listCurl_ssl_cfilter_removeCurl_async_thrdd_destroyCurl_creader_def_needs_rewindCurl_ssl_conn_config_updateCurl_connectCurl_async_is_resolvedCurl_urldecodeCurl_altsvc_saveCurl_hash_strCurl_httpchunk_readCurl_ssl_get_channel_bindingCurl_handler_httpCurl_hexasciitableCurl_httpCurl_req_hard_resetCurl_handler_tftpCurl_req_freeCurl_safecmpCurl_handler_mqttCurl_mime_prepare_headersCurl_conn_ev_data_doneCurl_bufq_lenCurl_auth_create_oauth_bearer_messagecurlx_uztoulCurl_creader_def_is_pausedCurl_uint_hash_initCurl_init_userdefinedCurl_pollfds_cleanupCurl_splayget__aeabi_d2ulzCurl_auth_create_plain_message__aeabi_ldiv0Curl_bufq_slurpCurl_creader_def_resume_fromCurl_waitfds_add_psCurl_pgrsTimeCurl_auth_create_external_messageCurl_httpchunk_encoder__floatundidfCurl_eventfdCurl_cf_send_bufqCurl_node_llistCurl_node_nextCurl_bufq_initCurl_trc_dnsCurl_doh_cleanupCurl_freeaddrinfocurlx_wait_msCurl_pollset_resetCurl_multi_ev_xfer_doneCurl_cf_ssl_proxy_insert_afterCurl_llist_countCurl_speedcheckCurl_dynhds_caddCurl_expireCurl_creader_def_cntrlCurl_conn_is_connectedcurlx_base64_decodeCurl_ssl_versionCurl_ssl_peer_key_makeCurl_handler_smtpCurl_uc_to_curlcodeCurl_http_req_make2Curl_addr2stringCurl_ssl_initcurlx_str_quotedword__aeabi_d2lzCurl_httpchunk_add_readerCurl_conn_is_ip_connectedCurl_auth_digest_get_pairCurl_mime_contenttypeCurl_xfer_recvCurl_pp_vsendfCurl_idnconvert_hostnameCurl_cwriter_freeCurl_retry_requestCurl_attach_connectionCurl_hmacitCurl_cpool_prune_deadCurl_auth_create_ntlm_type3_messageCurl_async_awaitCurl_xfer_recv_is_pausedCurl_xfer_pause_recvCurl_unix2addrCurl_meta_removeCurl_conn_cf_discard_allCurl_conn_meta_removeCurl_handler_ftpCurl_trc_timer_nameCurl_pgrsSetUploadCounterCurl_expire_clearCurl_cpool_addCurl_cf_h1_proxy_insert_afterCurl_trc_optCurl_pollset_want_readCurl_uint_bset_addCurl_multi_ev_assignCurl_req_startCurl_cf_udp_createCurl_uint_tbl_removeCurl_altsvc_parseCurl_multi_xfers_runningCurl_sha512_256itCurl_expire_doneCurl_is_in_callbackCurl_loadhostpairsCurl_uint_tbl_capacityCurl_GetFTPResponseCurl_cwriter_countCurl_uint_tbl_nextCurl_ssl_scache_add_obj__aeabi_uidivmodCurl_cf_def_sendCurl_http_resp_makeCurl_alpn_to_proto_bufCurl_uint_tbl_destroyCurl_uint_bset_firstCurl_altsvc_lookupCurl_debug__aeabi_daddCurl_headers_pushCurl_uint_tbl_countCurl_bufq_passCurl_splayremoveCurl_conn_cf_insert_afterCurl_conn_is_multiplexCurl_cft_tcp_acceptCurl_detach_connectionCurl_HMAC_updateCurl_h1_req_parse_readCurl_cpool_xfer_initCurl_creader_unpauseCurl_async_shutdownCurl_md4itCurl_conn_cf_get_transportCurl_initinfoCurl_rangeCurl_cf_createCurl_auth_create_digest_http_messageCurl_pollset_pollCurl_hash_countCurl_conn_closeCurl_bufq_initpCurl_bufq_creadCurl_bufq_peek_atCurl_llist_headCurl_http_auth_cleanup_digestCurl_waitfds_initCurl_altsvc_ctrlcurlx_str_cmpCurl_httpchunk_freeCurl_hsts_loadcbCurl_altsvc_cleanupcurlx_sltousCurl_conn_get_remote_addrCurl_creader_clear_eosCurl_ssl_scache_take__aeabi_uidivCurl_is_ASCII_nameCurl_cpool_do_by_idCurl_slist_append_nodupCurl_uint_tbl_resizeCurl_failfCurl_xfer_needs_flushCurl_resolv_pollsetCurl_creader_setCurl_timeleftCurl_bufq_is_fullCurl_ssl_set_engine_defaultCurl_bufref_memdupCurl_bufq_resetCurl_cpool_do_lockedCurl_mime_cleanpartCurl_cshutdn_countCurl_xfer_set_shutdownCurl_auth_decode_digest_http_messageCurl_creader_is_pausedCurl_secure_contextCurl_mime_add_headerCurl_meets_timeconditionCurl_multi_ev_cleanupCurl_DIGEST_MD5Curl_trc_writeCurl_fileinfo_cleanupCurl_multi_clear_dirtyCurl_xfer_flushCurl_pollset_moveCurl_conn_ev_data_pausecurlx_dyn_addnCurl_ip2addrCurl_http_write_resp_hdCurl_http_doneCurl_bufref_lenCurl_cf_def_cntrlCurl_conn_meta_getCurl_multi_xfer_ulbuf_borrowCurl_getformdatacurlx_str_passblanksCurl_multi_xfer_sockbuf_borrowCurl_openCurl_creader_def_readCurl_uint_tbl_firstCurl_multi_ev_dirty_xfersCurl_ssl_conn_config_cleanupCurl_cpool_check_limitsCurl_llist_insert_nextCurl_cfreeCurl_uint_bset_clearCurl_cf_http_proxy_insert_afterCurl_uint_spbset_containsCurl_bufcp_freeCurl_ntlm_core_mk_lmv2_respCurl_cookie_getlistCurl_conn_cf_needs_flushCurl_multi_will_closeCurl_thread_cancelCurl_conn_recvCurl_conn_cf_addCurl_sha256itCurl_multi_max_concurrent_streamscf_ip_happy_insert_afterCurl_uint_spbset_addCurl_cwriter_addCurl_cft_haproxyCurl_hsts_loadfilesCurl_multi_ev_assess_xfer_GLOBAL_OFFSET_TABLE_curlx_dyn_uptrCurl_creader_set_mimeCurl_altsvc_load__aeabi_i2dCurl_ssl_cf_get_primary_configcurlx_sotouzCurl_str2addrcurlx_str_trimblanksCurl_bump_headersizeCurl_conn_terminateCurl_conn_cf_get_socketCurl_conn_get_ssl_infoCurl_cookie_clearallCurl_cft_socks_proxycurlx_str_untilCurl_bufref_setCurl_cpool_findCurl_ssl_push_certinfo_lenCurl_cwriter_get_by_typeCurl_bufq_cwriteCurl_cf_unix_createCurl_sendrecvCurl_dynhds_freeCurl_shutdown_timeleftCurl_uint_hash_setcurlx_dyn_takeCurl_cookie_loadfilescurlx_base64_encodeCurl_cf_def_recvCurl_creader_resume_fromCurl_cft_unixCurl_shutdown_clearcurlx_dyn_addfcurlx_base64url_encodeCurl_ssl_randomCurl_fileinfo_allocCurl_uint_hash_getCurl_bufq_freeCurl_pp_flushsendCurl_cf_socket_peekCurl_expire_exCurl_cshutdn_run_onceCurl_hsts_parseCurl_client_cleanupCurl_auth_ntlm_remove__aeabi_drsubCurl_getconnectinfoCurl_auth_is_digest_supportedCurl_xfer_write_is_pausedCurl_creader_def_doneCurl_ssl_setup_x509_storeCurl_cf_haproxy_insert_afterCurl_uint_tbl_initCurl_pp_sendfCurl_xfer_sendCurl_multi_add_performCurl_conn_sendCurl_req_doneCurl_cpool_nw_changedcurlx_dyn_tailCurl_req_want_sendcurlx_timediff_ceilCurl_trc_feat_sslsCurl_resolv_unlinkSSL_CTX_use_PrivateKey_file@OPENSSL_3.0.0stdin@GLIBC_2.4curl_easy_option_nextUI_create_method@OPENSSL_3.0.0SSL_CTX_set_default_passwd_cb@OPENSSL_3.0.0SSL_get_error@OPENSSL_3.0.0ASN1_STRING_type@OPENSSL_3.0.0ERR_peek_last_error@OPENSSL_3.0.0EVP_PKEY_get_group_name@OPENSSL_3.0.0curl_easy_performX509_NAME_print_ex@OPENSSL_3.0.0UI_method_get_reader@OPENSSL_3.0.0SSL_read@OPENSSL_3.0.0pthread_mutex_lock@GLIBC_2.4curl_getdatecurl_multi_assignOSSL_LIB_CTX_free@OPENSSL_3.0.0SSL_CTX_free@OPENSSL_3.0.0pthread_mutex_init@GLIBC_2.4curl_mime_filenamecurl_multi_wakeupfnmatch@GLIBC_2.4curl_easy_getinfoENGINE_init@OPENSSL_3.0.0i2d_SSL_SESSION@OPENSSL_3.0.0BIO_set_flags@OPENSSL_3.0.0SSL_get_peer_cert_chain@OPENSSL_3.0.0__pthread_unwind_next@GLIBC_2.34EVP_get_digestbyname@OPENSSL_3.0.0ERR_peek_error@OPENSSL_3.0.0DES_set_odd_parity@OPENSSL_3.0.0curl_easy_sendgettimeofday@GLIBC_2.4recvfrom@GLIBC_2.4memrchr@GLIBC_2.4BIO_new_mem_buf@OPENSSL_3.0.0SSL_SESSION_get_timeout@OPENSSL_3.0.0curl_pushheader_bynameUI_method_set_closer@OPENSSL_3.0.0curl_easy_resetcurl_share_initi2d_X509_PUBKEY@OPENSSL_3.0.0fseeko64@GLIBC_2.4getsockopt@GLIBC_2.4OCSP_BASICRESP_free@OPENSSL_3.0.0SSL_CTX_set_verify@OPENSSL_3.0.0fdopen@GLIBC_2.4SSL_set_ex_data@OPENSSL_3.0.0UI_set_result@OPENSSL_3.0.0OSSL_PROVIDER_available@OPENSSL_3.0.0freeaddrinfo@GLIBC_2.4BIO_ctrl@OPENSSL_3.0.0zlibVersioncurl_mime_addpartcurl_easy_initfree@GLIBC_2.4SSL_CTX_set_cert_store@OPENSSL_3.0.0SSL_CTX_add_client_CA@OPENSSL_3.0.0EVP_PKEY_get_security_bits@OPENSSL_3.0.0inet_pton@GLIBC_2.4curl_unescapeSSL_CTX_set_post_handshake_auth@OPENSSL_3.0.0OSSL_STORE_load@OPENSSL_3.0.0getaddrinfo@GLIBC_2.4RSA_flags@OPENSSL_3.0.0SSL_get_ex_data@OPENSSL_3.0.0fseek@GLIBC_2.4BIO_s_file@OPENSSL_3.0.0i2t_ASN1_OBJECT@OPENSSL_3.0.0curl_share_setoptcurl_formgetcurl_url_cleanupqsort@GLIBC_2.4OCSP_response_get1_basic@OPENSSL_3.0.0BIO_meth_set_create@OPENSSL_3.0.0SSL_set_connect_state@OPENSSL_3.0.0curl_multi_pollPEM_X509_INFO_read_bio@OPENSSL_3.0.0curl_easy_strerrorSSL_alert_desc_string_long@OPENSSL_3.0.0X509_INFO_free@OPENSSL_3.0.0curl_easy_duphandlestrncmp@GLIBC_2.4UI_get_input_flags@OPENSSL_3.0.0SSL_get_verify_result@OPENSSL_3.0.0ENGINE_ctrl_cmd@OPENSSL_3.0.0curl_ws_start_framecurl_ws_sendcurl_url_dupSSL_ctrl@OPENSSL_3.0.0curl_escapeEVP_PKEY_get_bn_param@OPENSSL_3.0.0OCSP_cert_status_str@OPENSSL_3.0.0curl_slist_appendcurl_easy_headercurl_mime_datastrcspn@GLIBC_2.4SSL_get_shutdown@OPENSSL_3.0.0X509_EXTENSION_get_object@OPENSSL_3.0.0SSL_CTX_new_ex@OPENSSL_3.0.0UI_get0_user_data@OPENSSL_3.0.0closedir@GLIBC_2.4OCSP_CERTID_free@OPENSSL_3.0.0inet_ntop@GLIBC_2.4curl_urlOSSL_PROVIDER_unload@OPENSSL_3.0.0curl_strnequalENGINE_get_first@OPENSSL_3.0.0DES_ecb_encrypt@OPENSSL_3.0.0ENGINE_load_private_key@OPENSSL_3.0.0accept4@GLIBC_2.10ENGINE_ctrl@OPENSSL_3.0.0ENGINE_get_next@OPENSSL_3.0.0OPENSSL_sk_num@OPENSSL_3.0.0TLS_client_method@OPENSSL_3.0.0ERR_set_mark@OPENSSL_3.0.0PKCS12_PBE_add@OPENSSL_3.0.0stpcpy@GLIBC_2.4SSL_get_current_cipher@OPENSSL_3.0.0curl_mime_headerscurl_msnprintfX509_free@OPENSSL_3.0.0curl_global_init_memd2i_X509_bio@OPENSSL_3.0.0getpeername@GLIBC_2.4OSSL_STORE_INFO_get1_PKEY@OPENSSL_3.0.0SSL_get0_alpn_selected@OPENSSL_3.0.0feof@GLIBC_2.4curl_multi_setoptSSL_free@OPENSSL_3.0.0curl_multi_add_handlerealpath@GLIBC_2.4curl_mprintfcurl_mime_freei2a_ASN1_OBJECT@OPENSSL_3.0.0curl_multi_socketX509_STORE_add_cert@OPENSSL_3.0.0OBJ_obj2txt@OPENSSL_3.0.0readdir64@GLIBC_2.4sendto@GLIBC_2.4curl_easy_unescapeOSSL_STORE_open_ex@OPENSSL_3.0.0EVP_PKEY_free@OPENSSL_3.0.0BIO_set_init@OPENSSL_3.0.0ENGINE_get_id@OPENSSL_3.0.0d2i_PKCS12_bio@OPENSSL_3.0.0EVP_DigestFinal_ex@OPENSSL_3.0.0SSL_get_privatekey@OPENSSL_3.0.0curl_url_setPEM_read_bio_PrivateKey@OPENSSL_3.0.0curl_version_infoX509_STORE_load_path@OPENSSL_3.0.0CRYPTO_free@OPENSSL_3.0.0PKCS12_free@OPENSSL_3.0.0UI_method_set_reader@OPENSSL_3.0.0curl_ws_recvstrftime@GLIBC_2.4UI_method_get_opener@OPENSSL_3.0.0BIO_meth_new@OPENSSL_3.0.0OCSP_response_status@OPENSSL_3.0.0ENGINE_by_id@OPENSSL_3.0.0memset@GLIBC_2.4strspn@GLIBC_2.4opendir@GLIBC_2.4GENERAL_NAMES_free@OPENSSL_3.0.0OSSL_LIB_CTX_new@OPENSSL_3.0.0X509_verify_cert_error_string@OPENSSL_3.0.0pthread_detach@GLIBC_2.34curl_mvsnprintfrecv@GLIBC_2.4curl_multi_waitfdsBN_print@OPENSSL_3.0.0curl_multi_fdsetMD5_Init@OPENSSL_3.0.0curl_share_cleanupOCSP_crl_reason_str@OPENSSL_3.0.0curl_easy_pauseX509_STORE_set_flags@OPENSSL_3.0.0listen@GLIBC_2.4SSL_CTX_set_msg_callback@OPENSSL_3.0.0snprintf@GLIBC_2.4X509_ALGOR_get0@OPENSSL_3.0.0X509_get_signature_nid@OPENSSL_3.0.0curl_easy_recvEVP_DigestInit_ex@OPENSSL_3.0.0inflateSSL_CTX_use_certificate_chain_file@OPENSSL_3.0.0curl_easy_ssls_exportcurl_easy_nextheaderUI_method_get_closer@OPENSSL_3.0.0SSL_get0_verified_chain@OPENSSL_3.0.0poll@GLIBC_2.4SSL_get_version@OPENSSL_3.0.0OSSL_LIB_CTX_load_config@OPENSSL_3.0.0SSL_set_session@OPENSSL_3.0.0X509_STORE_free@OPENSSL_3.0.0memmove@GLIBC_2.4EVP_PKEY_get_id@OPENSSL_3.0.0strpbrk@GLIBC_2.4curl_maprintfcurl_multi_socket_allinflateInit2_unlink@GLIBC_2.4curl_mime_subpartsOCSP_basic_verify@OPENSSL_3.0.0OCSP_cert_to_id@OPENSSL_3.0.0BIO_s_mem@OPENSSL_3.0.0X509_check_issued@OPENSSL_3.0.0SSL_CTX_use_PrivateKey@OPENSSL_3.0.0SSL_write_early_data@OPENSSL_3.0.0inflateInit_X509_STORE_add_lookup@OPENSSL_3.0.0pthread_join@GLIBC_2.34OPENSSL_init_ssl@OPENSSL_3.0.0SSL_CTX_ctrl@OPENSSL_3.0.0gmtime_r@GLIBC_2.4clock_gettime@GLIBC_2.17realloc@GLIBC_2.4strcpy@GLIBC_2.4UI_method_set_writer@OPENSSL_3.0.0curl_multi_initUI_OpenSSL@OPENSSL_3.0.0curl_mime_namecurl_easy_escapeASN1_STRING_to_UTF8@OPENSSL_3.0.0curl_easy_cleanupSSL_CTX_set_cipher_list@OPENSSL_3.0.0SSL_CTX_sess_set_new_cb@OPENSSL_3.0.0curl_multi_performSSL_SESSION_get_max_early_data@OPENSSL_3.0.0X509_get_issuer_name@OPENSSL_3.0.0EVP_PKEY_get0_type_name@OPENSSL_3.0.0curl_url_getcurl_multi_waitSSL_new@OPENSSL_3.0.0curl_mime_filedataX509_get0_pubkey@OPENSSL_3.0.0freeifaddrs@GLIBC_2.4bind@GLIBC_2.4curl_mime_initBIO_free@OPENSSL_3.0.0pthread_setcancelstate@GLIBC_2.4inflateEndcurl_ws_metapthread_mutex_destroy@GLIBC_2.4X509_get_subject_name@OPENSSL_3.0.0X509_get0_extensions@OPENSSL_3.0.0stderr@GLIBC_2.4curl_easy_upkeepinflateReset2@ZLIB_1.2.3.4SSL_CIPHER_get_name@OPENSSL_3.0.0BIO_set_data@OPENSSL_3.0.0fread@GLIBC_2.4OBJ_nid2sn@OPENSSL_3.0.0EVP_sha1@OPENSSL_3.0.0curl_mvprintfUI_method_get_writer@OPENSSL_3.0.0BIO_meth_set_read@OPENSSL_3.0.0fileno@GLIBC_2.4EVP_PKEY_get_bits@OPENSSL_3.0.0curl_multi_cleanupRSA_free@OPENSSL_3.0.0SSL_shutdown@OPENSSL_3.0.0d2i_OCSP_RESPONSE@OPENSSL_3.0.0strerror_r@GLIBC_2.4socket@GLIBC_2.4EVP_MD_CTX_new@OPENSSL_3.0.0OPENSSL_sk_pop@OPENSSL_3.0.0curl_mfprintfBN_num_bits@OPENSSL_3.0.0BIO_meth_set_destroy@OPENSSL_3.0.0RAND_status@OPENSSL_3.0.0SSL_get_certificate@OPENSSL_3.0.0X509_NAME_get_entry@OPENSSL_3.0.0getifaddrs@GLIBC_2.4curl_multi_remove_handleSSL_CTX_set_ciphersuites@OPENSSL_3.0.0curl_freecurl_slist_free_allcurl_url_strerrorX509_get_version@OPENSSL_3.0.0strstr@GLIBC_2.4X509_LOOKUP_file@OPENSSL_3.0.0PEM_write_bio_X509@OPENSSL_3.0.0eventfd@GLIBC_2.7X509_get_ext_d2i@OPENSSL_3.0.0MD5_Final@OPENSSL_3.0.0X509_digest@OPENSSL_3.0.0X509_NAME_get_index_by_NID@OPENSSL_3.0.0OPENSSL_sk_value@OPENSSL_3.0.0curl_formfreecurl_mvsprintfOCSP_resp_find_status@OPENSSL_3.0.0d2i_SSL_SESSION@OPENSSL_3.0.0setsockopt@GLIBC_2.4select@GLIBC_2.4ERR_get_error@OPENSSL_3.0.0BIO_puts@OPENSSL_3.0.0curl_versiongethostname@GLIBC_2.4X509_get_X509_PUBKEY@OPENSSL_3.0.0X509_STORE_up_ref@OPENSSL_3.0.0ERR_clear_error@OPENSSL_3.0.0SSL_get_early_data_status@OPENSSL_3.0.0raise@GLIBC_2.4curl_share_strerrorcurl_formaddcurl_multi_get_handlesSSL_CTX_use_certificate_file@OPENSSL_3.0.0if_nametoindex@GLIBC_2.4curl_mvaprintf__pthread_unregister_cancel@GLIBC_2.34connect@GLIBC_2.4sigaction@GLIBC_2.4SSL_CTX_use_certificate@OPENSSL_3.0.0SSL_get0_group_name@OPENSSL_3.2.0SSL_set0_wbio@OPENSSL_3.0.0calloc@GLIBC_2.4BIO_get_shutdown@OPENSSL_3.0.0ftell@GLIBC_2.4pthread_cancel@GLIBC_2.34SSL_connect@OPENSSL_3.0.0OCSP_RESPONSE_free@OPENSSL_3.0.0curl_multi_info_readcurl_multi_socket_actioncurl_easy_setoptX509V3_EXT_print@OPENSSL_3.0.0X509_get_serialNumber@OPENSSL_3.0.0SSL_CTX_new@OPENSSL_3.0.0fgets@GLIBC_2.4OSSL_STORE_INFO_get_type@OPENSSL_3.0.0curl_mime_encoderfputc@GLIBC_2.4setvbuf@GLIBC_2.4fwrite@GLIBC_2.4RAND_bytes@OPENSSL_3.0.0EVP_PKEY_copy_parameters@OPENSSL_3.0.0memcpy@GLIBC_2.4ERR_pop_to_mark@OPENSSL_3.0.0curl_global_initgeteuid@GLIBC_2.4OSSL_STORE_INFO_free@OPENSSL_3.0.0SSL_CTX_set_keylog_callback@OPENSSL_3.0.0malloc@GLIBC_2.4curl_easy_option_by_idstrlen@GLIBC_2.4curl_msprintf__pthread_register_cancel@GLIBC_2.34BN_clear_free@OPENSSL_3.0.0BIO_clear_flags@OPENSSL_3.0.0SSL_set_alpn_protos@OPENSSL_3.0.0X509_get0_signature@OPENSSL_3.0.0OSSL_PROVIDER_try_load@OPENSSL_3.0.0UI_destroy_method@OPENSSL_3.0.0fclose@GLIBC_2.4X509_EXTENSION_get_data@OPENSSL_3.0.0DES_set_key_unchecked@OPENSSL_3.0.0lseek64@GLIBC_2.4EVP_PKEY_get1_RSA@OPENSSL_3.0.0PKCS12_parse@OPENSSL_3.0.0BIO_up_ref@OPENSSL_3.0.0curl_multi_timeoutcurl_pushheader_bynumX509_STORE_add_crl@OPENSSL_3.0.0ASN1_STRING_print@OPENSSL_3.0.0OBJ_find_sigid_algs@OPENSSL_3.0.0curl_mvfprintffcntl64@GLIBC_2.28stdout@GLIBC_2.4OSSL_STORE_INFO_get1_CERT@OPENSSL_3.0.0curl_multi_strerrorSSL_CTX_check_private_key@OPENSSL_3.0.0X509_get0_notAfter@OPENSSL_3.0.0ERR_error_string_n@OPENSSL_3.0.0X509_get_pubkey@OPENSSL_3.0.0curl_multi_get_offtBIO_new@OPENSSL_3.0.0X509_STORE_load_file@OPENSSL_3.0.0X509_PUBKEY_get0_param@OPENSSL_3.0.0ENGINE_set_default@OPENSSL_3.0.0BIO_meth_free@OPENSSL_3.0.0strcmp@GLIBC_2.4PEM_read_bio_X509_AUX@OPENSSL_3.0.0ENGINE_finish@OPENSSL_3.0.0X509_get0_notBefore@OPENSSL_3.0.0EVP_sha256@OPENSSL_3.0.0SSL_CTX_set_srp_password@OPENSSL_3.0.0BIO_set_shutdown@OPENSSL_3.0.0curl_global_cleanup__errno_location@GLIBC_2.4curl_easy_option_by_namesend@GLIBC_2.4curl_global_sslsetmemchr@GLIBC_2.4OSSL_STORE_expect@OPENSSL_3.0.0fflush@GLIBC_2.4BIO_meth_set_write@OPENSSL_3.0.0UI_method_set_opener@OPENSSL_3.0.0SSL_CTX_set_srp_username@OPENSSL_3.0.0fopen64@GLIBC_2.4memcmp@GLIBC_2.4OPENSSL_sk_pop_free@OPENSSL_3.0.0__xpg_basename@GLIBC_2.4EVP_MD_CTX_free@OPENSSL_3.0.0fstat64@GLIBC_2.33__sigsetjmp@GLIBC_2.4TLS_method@OPENSSL_3.0.0pthread_create@GLIBC_2.34SSL_CTX_set_default_read_buffer_len@OPENSSL_3.0.0PEM_read_bio_X509@OPENSSL_3.0.0EVP_sha512_256@OPENSSL_3.0.0strrchr@GLIBC_2.4curl_mime_typeOCSP_response_status_str@OPENSSL_3.0.0ASN1_STRING_get0_data@OPENSSL_3.0.0SSL_SESSION_free@OPENSSL_3.0.0getsockname@GLIBC_2.4SSL_get1_peer_certificate@OPENSSL_3.0.0SSL_set0_rbio@OPENSSL_3.0.0ASN1_STRING_length@OPENSSL_3.0.0SSL_CTX_get_cert_store@OPENSSL_3.0.0OCSP_check_validity@OPENSSL_3.0.0OSSL_STORE_close@OPENSSL_3.0.0fputs@GLIBC_2.4getenv@GLIBC_2.4BIO_get_data@OPENSSL_3.0.0SSL_get_peer_signature_type_nid@OPENSSL_3.0.0curl_strequalSSL_CTX_set_options@OPENSSL_3.0.0__gmon_start__SSL_CTX_set_default_passwd_cb_userdata@OPENSSL_3.0.0getpwuid_r@GLIBC_2.4rename@GLIBC_2.4ENGINE_free@OPENSSL_3.0.0EVP_DigestInit@OPENSSL_3.0.0MD5_Update@OPENSSL_3.0.0EVP_DigestUpdate@OPENSSL_3.0.0X509_load_crl_file@OPENSSL_3.0.0curl_global_tracestrchr@GLIBC_2.4__cxa_finalize@GLIBC_2.4SSL_write@OPENSSL_3.0.0OpenSSL_version@OPENSSL_3.0.0curl_getenvcurl_mime_data_cbcurl_easy_ssls_importpthread_mutex_unlock@GLIBC_2.4ASN1_TIME_print@OPENSSL_3.0.0strdup@GLIBC_2.4d2i_PrivateKey_bio@OPENSSL_3.0.0UI_get_string_type@OPENSSL_3.0.0BIO_meth_set_ctrl@OPENSSL_3.0.0X509_NAME_ENTRY_get_data@OPENSSL_3.0.0__isoc23_strtol@GLIBC_2.38sched_yield@GLIBC_2.4BIO_printf@OPENSSL_3.0.0.symtab.strtab.shstrtab.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.fini_array.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributes.debug_aranges.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_line_str.debug_loclistsl o` ` %  ---45oPJPJBoMMQ NN(Z Bwwx c ^((i( ou  T}pt t  | |     '    4T T 0T "pv 1 ` 3;   @0 y *09 ':` |" `!' <2 ̦ J