ELF(44 (#"p   444  TTT0 0      QtdRtd 00/lib/ld-linux-armhf.so.3A6 6I<*0b@hi0S, Ce^s"B~\HLx(Efa!~Vzz+%;*~)::{|)I 8$&Gr ~zrX?FDMK^w/N`>;yC6 tUiP|gFun, qG66#l2?HkC/|.MPE[: (,+&e$ijxsE  W{l 5'=JZ7nVKv]]g$7!Yj%/m }9XRQe`&(G`4z[k[$s/PPh]WjhOT^yxU=K7?xM0'QABdM*D/?}-8Wa o>Jl@ZRPi-CaRq]ZQd.qa$& O"NvC1c4|w9jsUh;,g-RL% hF5 !2*>Y4Hwts Q0T`ui)"d Sb6>@&<}nz;LdT S3e -?( tJLD7ZU=$O|#{B) r,].Bj9<(O4'1FF &CD;7Q+m W}*uMy348 0uvcvg)Bcdx8 o^^qHx/T'v@l_v\~f3`PT{f.1t>)y G\rgfG_buLn+=IF%_jlW^RZSArz8NpY+D."`dQ&FD %/Ve1z+Ok<T<?m6!4S@ cK#h3wjE*2 )hZ3=p]r]Xt['U[H>m:AZ5[!Wg-\lf91=I0DT'#|:o-y{f X";f-p"bud>#~MwVno"k(.i~#!Y78%p'c_RNku`M_[BRXe*2A }5H  2a(O@AxKyY5Lo ^N<y_KC\!wGmJY Iskor  $Iq%XS2Iqo1p\7 V:bLaYcJvmP\Nst:4qlV9}A,9 JKi}pbk.+ On5nw2<ep X8WUJ,5BG{Sa_E?#3gU;VHQ E|t{c@mE1N=903b#A D 1`"1I @(BD@@0 Q!@"` JB$@PhK@Ae0!Bd0X(  D2B$ P0@HH0mP(@ b "0H!]  RT$   @ "`ā 8;5&@B @h P!a &R(DH t" @ H8@@ A!T@$*BʔD(P i@$YT|A@dP 0 @ Ą@ !ī, % @@ @!@@X@hDHb @ "E@ @  #D@'" ta"  "@ Dx L#pX@)1#D@U* ē  ( 6A @@!@(!h@H, H@@!0`I 2"@h0 @&%P LD@ l% T" `DX-D D &tt4Y(0(D `B 08@`S B1@@"Հ$LD `H@hI 1 @* @ d8("X A @"` @ 2@ 2@(A @ABC DC@@@@ ґ @H@$RH0FFv40@ @JA"BBA0Q 9 $0E:$ @P0@@@4$%ۂ,*CQ@! Bl "L!`H2,A B  8" ALB # Yj8@)ET @"@@ @ Bb )@ AJ(! IQ€H!5 BDP"P BDP1h,@  e $ Q 6 ;!\B #@T`  ) D$D "IhD(``&$""0Kf!6@%D 0 J4 @( ` PH@@=@JT dP-PR B"@a  , $`G5 @ "M")B@!  @@@)A, Tp@ @H@X@%j@B4 )$` @0B00 F,  4  a p3A Ā@ %BB=R@Dr !%'(+,.0367:<=?CFHLNQSVX\_acdefhijlnoqtuwxz{   #$')*-/0125679:>AEHJKLMNQRUX[^adfgijmoqstvwy{}~   !$%')+03678;<?@CDEGJLMNOPRTVXY[]^_`cdfhknoprtuw{   "$&(*+/37;=>@ADEGHKPRTUVYZ[\^bcehikmosuv{}  !"$'()-.01789;=@ADGIKLMPSTUV\^`bdeghjklmqrtwx{  !#&'(),/123589:<?BDGJKMNOPQRTUVX[\^dfhijklmpqtuvxyz{}  !#%&)+,.0134789<=@ABCEFGJLOQSTUVWXY[\]`abeghklortuvy|^gٜ987>| q91 16eZ1gXފRWycA0z?+ 4 (׌,7sU.}&X s\8=׍@F2Rzݹ8ps^1m : ]ΚuV\AԿZ},rQZ`OfO1\Cq$P8\0Ŝ_ʷpy&-ɼ,2@k ֙ Hrh70b"I[i(bM:lf>`F-=evw9x!qmIfWg]Lw5eWm ۿ+e$t7D;{| 1,ٶ on񆙋gx(pݎƀ-.:>nA"m73=+֌@ud_P"ﶱw\$n= #a #}JjȒ]Wt znIydHU殈7T%֛GC"ʘTp3A=)<"٬=)<ӏ9̖DLyn$_]dl>n޽ 8dRT90輒DM3].w@].Qi `dUT T]4deBDώHw氖}q `R|DK!T謮AP̵2 * ^dt>s7uawxZڧx!hO.J(жaRU^p/KC&"5dť z^_ ;wֺy;qM.z3漓#{/&ED"Z*x3`PUHyjEM.0Ee=1 X*;~>5[W qE~JV7+;fUa(IQ, lFd(x(i6+  EM2U ]̔ %4 N~sEM 2J\S2}ZXZB9Uu/зd`s4`>g%al+4/GY)LXg82 .@=8RLRr~!ysG|;}ƘDO,2J@^f)m`AM|oSv~BJ³e Fq7J *  k 5S^){E\ ZC h J@V|FtK}@Q,h<3QQeYGaV2LRCHHEǠK9 E`Xձ?D,HG['b8@!,{ d45T$h5׷˖TZ8Dr|`!̞$fy`6&^5/Da(f`xYjhLz:e;d^hq+Wl Q 3rvCNd&ܠpS+pR(MU \(vB*d3T#W @27Bkt*7һ ߱lYhx/'adw*Eێ)m #y>ʁP1#e;u3!itEo_J".D|ZIۯ% "67KḿE> Hs\ }y /US9 _:7ܷ`+kRO\"l &Ҏ"n'GRlD:Q2k+Y[/ߺpok&romw"YyUp*ohߣI>vfG֎zGtm $d0뀥ds)=Uy@y"$f4tsϵ|AgDR\fII"kR:Md?\rKY1Ag4? l=~<uM!ιm[(8s w>wKsJ Þ˚0fc$)cb؇+LUpFwt:VC, g=sT#o4c_YKFt\DHSPV~Csl^߈!^MZ?:"MlLޕ$:ojG5LJNH[Ptz"1v?iLFc,P#sʰ%h @.&g"ʻw531JEԾԇ+** $uqfMs|iC[zdȝJڱ.*Ϳ\2h%^buJ&sF! ؔA]=o@<Պ4g/+Y.=(St3xy,ةշwכ|7ZW?)G46n+!P͐2zc^*:CmnYVQKy}'#4* i^kpCHNHȨ^q!ՈFGP{E},>~|ga! "y(Jp0_M%aq (1~L<4U(Iy@l|W(PU*Sc#IA TIjjU-YKw4sB)RqsKH[|7Y..1N pW2c?r56%u <$ /wS4 %̑PnDbhx?V#9R-9}5h:*M"ߊcT8[^FС @[T~R7݂y]vX2qOEf z01 ש>MeZs=x#MP:QFܴC&B1ڂFPB 8ֆ\o]:'&f^0B~݌ 0ހu jGCJsbApƧ;n\%V1A>b=0WŦݺ%\i +㗤|>Y+K&9{aP:]= "‘/Jj! Q1Dg&N$5#.DEC5th(54(i;b@ .<(_suLO]29ҞjjWzzW?tḩα2~C:xƏ>,$6 NX뚎7Fv؍.&,u ;‚-=K?E0h $6}g-e2FgIZA|{%>}(Dgftuw m0$yJ~h}$q,(P,O(k.oLD^ֈyGS#&C/tg3W:ޚBdK8|\kc,;,R8kCFk8}+ !"@ zuYV\ )B$\jw8oΈM8G$ÎO6)do%{ `̗{ͅyݟE? !4X@DJod |vvsa b`5*@ZQuFN<4,.{<_0׀<X&\̢AU)}"?:Ry!Sgj$M/S񬕘K}jrȅtGT?P;Ѝ OZkt?iAcI9mǟ8 fjQims~5sf,xch dz  Ğ[h, UsL90W%K:3[ړ_Hn~lY o# scm}|_<Gk}kJ9,H{-[ڣ-hK+ {X(ޓZ-I9lR%T H+w%!Bܟ 7ޓI9s  &h5H.7{W7v:2%R.&A2\|lwV dP@?:WYY%{"W@DH\b-orጩ|%A<|b'J,XmAw#қP6}Pp+so$Mtoڎ!/['7fw?Ix>Tx9@ c+601%dCc͑& Xgozp3.$\]QZ#ɻҩ|#S%2oYLTh\>LCRgT@H@6>F*܅J+=a'`gitP?7L>1ItfL$fy  &-8N"~muZy*'JM9pWN\ _/#Xz:q}rH F1w+Ƚ|yMM gwu '0G3sEU, QY̤}|8XPBNك7BN~ % nυ*x l``0ʖWzD7'fJ,¢O3x+p(ICc+Q=^aaofNת3Amgq}XV&!m^^*kfʱ$$WۓkGw'bh,-!EՏG21j,K5cf㧜-VqE~ 9{Ќ率$&PI'a1V𪶌$bUF3>![NUk{0.۵z'wXԲ%%wAf"ƫg<[G { l %n0'X"]!P! 8X%پ{Z:_ 4b S184%ԸB0 Vᙗ)h:;L#=˥Ft$FwK-T)]tXc"r~p&n8gĭ^%4/E"P*:S H%{^NGE(eYdhD#KL%Uqz̫pxsRc'H | Hp<[MtWfvHo8$V,vjGջi%7@* 1(l G]DWNIt|J 6N`lM2g"z؄ 0sN!U3yfg/:Hj)m== % k~ MLeHK -W97sU9^cV 13ni` E*kqVcw9uu{T8;~cpREp}O؟5CU9 <5PiO ,l1&3T['-b Dat])I)z %Jc-SfJtOev+8 ~N y s.vL8&F_#pyQipy UvH2BAZZ:4 X0; zCL} 8J n^Upo?>\\pL\<u oCa'm}ydG0]?[YX~Qςvx];IK'%S%) II.g!TjnxhQW{DTZ ]VsEJ(2kb?MDV+n&_j@"oo>5%ZjzD'qn*Q3CH(!it'6-DpvY-0#M~M  =wPs3{[wEdgD<%0E ~x& Ha`, > TNhXNGns9Xc_rCS/qa*S&}X3YZJQ;bS_-oxNe'mc)XZ%4U*q6:_'!V 7lw<zeX<L(,-| lf7-TM#$]Ka2GO$hX6pZTWks2AS4*j?3aw=A}C'  K k*]~XKvpkfic&gIrP=gi3<QK_ WD{Sfr</tAKFYiV8Gwq?a(v+P7+] p ]3oUwH|=: l%>D`dnU:AtMEC!"> 'dZń 6'n^f9vhx)6VKD@ `?N"K?"=F4^=K%$[g!?0-s%><+aP$m<9dTNI م[?frLI0bIk XU*  x)9(4B6Fz@ggJsUIvY0wm_@Lfd"hrzP 85O&OnD{"~}=!"rYDuA3Nh-`cO7>29|iuJYo8^dL~!@B:fQ I;_$Vrx{:C8_dZmszfzR@S:cl>': #<c/s3]>RJu'D7Kb'r2= (3l0KP"J3"9>{C+kMVr{;&ڈnp',$ 8@t !SG#zN <9CD4o&t/H] 5 2<;*>B_qR_kR)k_8bl5"#_hV#u^Mkr0_xJg}GG7VVgl̺)R_uO&K* zw0>$u`CsNoKKNLIu @l83|(%m:&u/+Y/"Wġe [:$O$x9T9p<!fq H 9iWum9~dT kT>e s>_@ A815&"HG1?o9VoG=ZBR'GML|_<D,Zx"oaĂ ~!%  tmlupNmKD!|X}}ĞxKA{K>$yX}jf8Q:OASnri{!. ?_+,mK  L.';.Outa]$nUm6ahMh[:)EM6v*ze3yjb#(AZ6oY ,/SXV^%y[Ѐb݃|FJW,x``hh7./NHk.$<\X.?[^fPwSoBx#FtI|QSQ/OTlw^ q%/5#e,WyModwyexaj;on4( 3#axTfp`f ^yjs:h)!|VF0+S{Q;_)f,5{|lЇpWg]W^NM8`O_~'@x{fgb"?j>9Ugv'Yo 8 { SaHcXZ8G|xV[EN^ }c2%dyCPNN[XsJG.X1lw3r'f;k)(Y4$44L5w?CQ<?A)t(+tz(QT; *s#܇_\[R{ Op YicnkTÅ, *eIg5}@qnfHc8Ag d"7ea UzO4"xb \C(D} Z]Vz2;9r~i lV3y.AyA1B|_;h|9|=+bE`eg|WR:B_:`K u%PI$\4W" I;18xSo|," Bӈ]PUS5__gmon_start__SSL_CTX_get0_certificateSSL_set_sessionSSL_is_serverSSL_SESSION_get_idSSL_get_errorSSL_CONF_cmdSSL_CTX_freeSSL_CTX_use_serverinfo_fileSSL_set_accept_stateSSL_alert_desc_string_longSSL_set_srp_server_paramSSL_get0_dane_tlsaSSL_CTX_set_srp_verify_param_callbackDTLS_server_methodSSL_get0_peer_CA_listSSL_set_post_handshake_authSSL_get_negotiated_client_cert_typeSSL_CTX_load_verify_fileSSL_SESSION_freeSSL_certs_clearSSL_get_ciphersSSL_SESSION_set_cipherSSL_readSSL_state_string_longSSL_CTX_set_max_early_dataSSL_set_blocking_modeSSL_SESSION_print_keylogSSL_CTX_set_default_verify_fileSSL_CTX_set_client_CA_listSSL_get_srp_NOSSL_QUIC_client_methodSSL_get_shared_sigalgsSSL_CTX_get0_ctlog_storeSSL_CTX_set1_server_cert_typeSSL_get_selected_srtp_profileSSL_CTX_ctrlSSL_CTX_set_next_protos_advertised_cbSSL_callback_ctrlSSL_CTX_set_stateless_cookie_verify_cbSSL_get_SSL_CTXSSL_CTX_sess_set_remove_cbSSL_get_srp_gSSL_CTX_set_ctlog_list_fileSSL_set_optionsSSL_verify_client_post_handshakeSSL_set_msg_callbackSSL_get_verify_resultSSL_CTX_get_cert_storeSSL_get_servernameSSL_CTX_set0_security_ex_dataSSL_use_certificateSSL_SESSION_set_protocol_versionSSL_SESSION_get0_cipherSSL_CTX_set_cookie_verify_cbSSL_CTX_set_srp_strengthSSL_CIPHER_findSSL_CIPHER_get_handshake_digestSSL_CTX_load_verify_dirSSL_CTX_configSSL_CONF_CTX_freeSSL_CTX_sess_set_get_cbSSL_CONF_CTX_finishSSL_CIPHER_descriptionSSL_has_pendingSSL_CTX_use_PrivateKey_fileSSL_CTX_set_psk_use_session_callbackSSL_statelessSSL_write_early_dataSSL_CTX_set_ciphersuitesSSL_clearSSL_connectSSL_is_quicSSL_set_bioSSL_SESSION_printSSL_CTX_set1_client_cert_typeSSL_CTX_set_psk_server_callbackSSL_get_sigalgsSSL_dane_tlsa_addSSL_use_PrivateKeySSL_session_reusedSSL_CTX_set_srp_cb_argSSL_CTX_set0_tmp_dh_pkeySSL_get_sessionSSL_get0_next_proto_negotiatedSSL_CTX_set_quiet_shutdownSSL_CTX_set_default_ctlog_list_fileSSL_get0_peer_certificateSSL_CTX_use_psk_identity_hintSSL_renegotiateSSL_get_event_timeoutSSL_CONF_CTX_set_ssl_ctxSSL_get0_dane_authoritySSL_SESSION_set1_master_keySSL_set_connect_stateSSL_SESSION_up_refSSL_CTX_set_keylog_callbackSSL_dane_set_flagsSSL_ct_is_enabledSSL_is_init_finishedSSL_CTX_compress_certsSSL_CTX_use_PrivateKeySSL_COMP_get_nameSSL_acceptSSL_CTX_get_security_callbackd2i_SSL_SESSION_exSSL_shutdownSSL_get_current_cipherSSL_writeDTLS_client_methodSSL_CIPHER_get_idSSL_net_read_desiredSSL_CTX_set1_paramSSL_get_optionsSSL_get_peer_signature_type_nidSSL_CTX_callback_ctrld2i_SSL_SESSIONSSL_SESSION_get_max_early_dataPEM_read_bio_SSL_SESSIONSSL_get1_builtin_sigalgsSSL_set_session_id_contextSSL_CTX_set_session_id_contextSSL_CTX_set_stateless_cookie_generate_cbSSL_get0_peer_sctsSSL_CTX_set_not_resumable_session_callbackSSL_CONF_CTX_newSSL_CTX_check_private_keySSL_check_chainSSL_CIPHER_get_versionSSL_dane_enableSSL_CTX_set_optionsSSL_CTX_set_next_proto_select_cbSSL_get_key_update_typeSSL_set_SSL_CTXSSL_CTX_set0_CA_listDTLSv1_listenSSL_CTX_set_psk_client_callbackSSL_get_srp_usernameSSL_CTX_sess_set_new_cbSSL_CIPHER_get_nameSSL_set_shutdownSSL_get_early_data_statusSSL_CTX_add_client_custom_extSSL_stream_concludeSSL_SESSION_newSSL_CTX_use_certificate_fileSSL_CTX_set_default_read_buffer_lenSSL_CTX_set_default_verify_dirSSL_get0_peernameSSL_CTX_set_alpn_protosSSL_waiting_for_asyncTLS_methodSSL_get_shared_ciphersSSL_CTX_set_psk_find_session_callbackSSL_handle_eventsSSL_load_client_CA_fileSSL_get_all_async_fdsSSL_CTX_set_cookie_generate_cbSSL_CTX_set_verifySSL_key_updateOPENSSL_cipher_nameSSL_CTX_load_verify_storeSSL_get_wbioSSL_get_versionOPENSSL_init_sslSSL_get0_peer_rpkSSL_SESSION_get0_peerSSL_CTX_set_alpn_select_cbSSL_net_write_desiredSSL_SESSION_set1_id_contextSSL_is_dtlsSSL_get_current_expansionSSL_get0_alpn_selectedSSL_select_next_protoSSL_read_early_dataSSL_get_certificateSSL_CTX_set_srp_username_callbackSSL_CIPHER_standard_nameSSL_set1_server_cert_typeSSL_do_handshakeSSL_get_current_compressionSSL_freeSSL_CONF_CTX_set_flagsSSL_CTX_set_default_verify_storeSSL_get_rbioSSL_CTX_set_info_callbackSSL_CTX_set_cert_storeSSL_get1_supported_ciphersSSL_CTX_set_srp_client_pwd_callbackSSL_add_file_cert_subjects_to_stackPEM_write_bio_SSL_SESSIONSSL_get_fdSSL_CTX_new_exSSL_CTX_set_client_cert_engineSSL_get_negotiated_server_cert_typeSSL_ctrlSSL_CTX_set_tlsext_max_fragment_lengthSSL_CTX_set_tlsext_use_srtpSSL_CTX_set_srp_usernameBIO_f_sslSSL_CTX_set_recv_max_early_dataSSL_set_verifySSL_set1_initial_peer_addrSSL_alert_type_string_longSSL_get_servername_typeBIO_ssl_shutdownSSL_newSSL_CTX_set_cert_cbSSL_export_keying_materialSSL_get_peer_cert_chainSSL_CTX_newSSL_has_matching_session_idSSL_CTX_set_security_callbacki2d_SSL_SESSIONSSL_CTX_set_generate_session_idSSL_CTX_enable_ctSSL_set1_client_cert_typeSSL_CTX_set_cipher_listSSL_traceSSL_CTX_dane_enableSSL_CTX_use_certificateSSL_group_to_nameOSSL_ENCODER_do_all_providedX509_PURPOSE_get_countOSSL_ENCODER_CTX_get_num_encodersPKCS12_SAFEBAG_get0_attrOSSL_DECODER_do_all_providedPKCS8_pkey_get0_attrsEVP_SIGNATURE_names_do_allBIO_ADDRINFO_familyX509_get0_pubkey_bitstrENGINE_load_public_keyBN_num_bitsASN1_GENERALIZEDTIME_printX509_POLICY_NODE_printNCONF_freeOSSL_STORE_SEARCH_by_aliasX509_STORE_CTX_get0_policy_treeEVP_PKEY_newENGINE_ctrlEVP_CIPHER_CTX_set_flagsOSSL_STORE_unregister_loaderEVP_EncryptUpdateEVP_PKEY_verify_recover_initASN1_item_freeRAND_get0_primaryBIO_bindEVP_DigestInit_exX509_NAME_entry_countEVP_sm3PKCS7_sign_exd2i_OCSP_RESPONSEPKCS12_SAFEBAG_get0_attrsSRP_create_verifierEVP_CIPHER_names_do_allASN1_UNIVERSALSTRING_to_stringOPENSSL_DIR_readASN1_TYPE_freeEVP_ASYM_CIPHER_is_aOPENSSL_buf2hexstrASN1_UTF8STRING_newNETSCAPE_SPKI_b64_encodeOPENSSL_sk_deleted2i_X509_REQ_bioUI_destroy_methodOSSL_CMP_ITAV_new0_certReqTemplateASN1_ITEM_lookupBIO_lookup_exPKCS12_init_exX509_STORE_set_default_paths_exOPENSSL_sk_set_thunksX509_ocspid_printX509_REQ_set_pubkeyEVP_PKEY_decapsulateCMS_ContentInfo_print_ctxOSSL_CMP_ITAV_freeRAND_statusOCSP_onereq_get0_idEVP_MAC_fetchCMS_add1_signeri2d_OSSL_CRMF_CERTTEMPLATEOBJ_obj2nidOSSL_PARAM_get_int64OSSL_HTTP_proxy_connectNCONF_new_exGENERAL_NAME_freeERR_peek_last_errori2d_RSAPublicKey_bioX509_ATTRIBUTE_freeBN_is_zeroEVP_DigestVerifyFinalX509_CRL_get0_lastUpdatei2d_PKCS8PrivateKey_bioEVP_SIGNATURE_up_refOSSL_PARAM_get_uint64PKCS12_unpack_authsafesEVP_DigestInitX509_verifyOSSL_ENCODER_to_bioPKCS7_new_exEVP_KEM_settable_ctx_paramsOSSL_PARAM_construct_uintX509_STORE_CTX_initEVP_MD_up_refEVP_CIPHER_do_all_providedi2d_PUBKEY_bioEVP_KEYEXCH_freeOSSL_CMP_CTX_push0_genm_ITAVOSSL_CMP_CTX_reqExtensions_have_SANBN_is_oddOSSL_CMP_CTX_get1_newChainOSSL_CMP_ATAV_get_rsaKeyLenX509_REQ_set0_distinguishing_idOSSL_STORE_INFO_get_typeUI_processPKCS7_get0_signersOSSL_STORE_INFO_freeOSSL_PARAM_construct_endX509_LOOKUP_fileCMS_get1_ReceiptRequestOPENSSL_LH_errorPEM_write_bio_X509_AUXOCSP_resp_get0_signatureOSSL_CRMF_CERTID_get0_serialNumberd2i_PKCS12_bioASYNC_cleanup_threadOSSL_ENCODER_CTX_set_passphraseEVP_CIPHER_get0_nameOSSL_CMP_CTX_set1_expected_senderOSSL_CMP_SRV_CTX_set_grant_implicit_confirmCRYPTO_strdupPEM_write_bio_CMS_streamEVP_PKEY_CTX_freeX509_set_subject_namea2i_GENERAL_NAMEEVP_CIPHER_get_nidOSSL_STORE_do_all_loadersEVP_SIGNATURE_get0_descriptionX509_EXTENSION_get_dataERR_set_errorOSSL_CRMF_MSG_centralkeygen_requestedCMS_RecipientInfo_typePKCS5_pbe2_set_scryptBN_printX509_keyid_set1BN_GENCB_freePKCS12_SAFEBAG_get0_bag_typeEVP_PKEY_meth_get0_infoBN_add_wordEVP_SIGNATURE_do_all_providedEVP_MD_names_do_allCMS_decrypt_set1_keyX509_CRL_printPKCS12_SAFEBAG_get1_certOSSL_CMP_CTX_reinitX509_VERIFY_PARAM_set_timeX509_digestOSSL_CMP_SRV_CTX_initCMS_add0_recipient_keyOSSL_CMP_CTX_set1_oldCertUI_method_set_prompt_constructorERR_newOSSL_CMP_CTX_set1_referenceValueEVP_MD_is_as2i_ASN1_INTEGEREVP_PKEY_missing_parametersEVP_MAC_is_aX509_to_X509_REQASN1_OCTET_STRING_freeTXT_DB_get_by_indexOCSP_check_validityX509_add1_trust_objectCMS_compressEVP_KEYEXCH_names_do_allOPENSSL_sk_sortOSSL_CMP_CTX_set_log_cbEVP_MAC_updateX509_CRL_load_httpOpenSSL_versionOSSL_CMP_ITAV_get0_typeOSSL_CRMF_CERTTEMPLATE_newASN1_TYPE_newOSSL_DECODER_CTX_freeOSSL_CMP_CTX_set0_reqExtensionsOSSL_CMP_CTX_print_errorsEVP_SKEYMGMT_up_refTS_REQ_set_nonceX509V3_EXT_REQ_add_nconfEVP_MD_gettable_paramsUI_method_get_closerOBJ_nid2objEVP_PKEY_asn1_get0X509_VERIFY_PARAM_set_auth_levelOPENSSL_sk_numPKCS7_sign_add_signerEVP_CIPHER_is_aOPENSSL_LH_freeBIO_readEVP_SKEYMGMT_fetchPBEPARAM_itASN1_item_d2iOSSL_PARAM_construct_intOSSL_ENCODER_up_refi2d_PKCS7_bioPKCS12_get0_macCRYPTO_secure_malloc_doneERR_get_errorOSSL_PROVIDER_add_conf_parameterX509_STORE_CTX_get0_parent_ctxOSSL_STORE_LOADER_newX509_CRL_verifyENGINE_get_idX509_subject_name_hashEVP_SIGNATURE_fetchEVP_SIGNATURE_is_aOSSL_CMP_CTX_set1_srvCertX509_add1_reject_objectEVP_KEYEXCH_get0_nameOSSL_ENCODER_fetchASN1_STRING_freeOSSL_STORE_LOADER_get0_providerEVP_CIPHER_CTX_set_paddingX509_check_ip_ascEVP_SKEYMGMT_freeX509_get0_pubkeyRAND_write_filePEM_read_bio_X509_REQX509_ALGOR_freeBIO_connectCMS_EncryptedData_decryptUI_add_verify_stringX509v3_get_ext_by_OBJX509V3_set_nconfNETSCAPE_SPKI_freeEVP_PKEY_verify_initEVP_PKEY_CTX_set_paramsOCSP_cert_status_strX509_add_certsASN1_INTEGER_to_BNX509_STORE_load_fileOSSL_PARAM_construct_octet_stringEVP_RAND_freeX509V3_set_ctxX509_CRL_get_issuerEVP_KEM_is_aTS_MSG_IMPRINT_set_algoEVP_SKEYMGMT_get0_nameX509_LOOKUP_hash_dirCRYPTO_memdupEVP_PKEY_sign_initBIO_free_allEVP_MAC_do_all_providedX509_NAME_get_index_by_OBJX509_get_default_cert_dirBIO_printfCMS_RecipientInfo_kari_get0_ctxX509V3_set_issuer_pkeyX509V3_parse_listOSSL_HTTP_getEVP_PKEY_asn1_find_strX509_ALGOR_itEVP_MD_do_all_sortedTS_RESP_verify_tokend2i_TS_REQ_bioASN1_tag2strX509_STORE_set1_paramX509_get_ext_countEVP_MD_CTX_set_pkey_ctxPBEPARAM_freei2d_X509_bioBIO_number_readOSSL_STORE_SEARCH_by_nameX509_CRL_digestEVP_sha256EVP_ASYM_CIPHER_names_do_allEVP_PKEY_encapsulate_initTS_TST_INFO_freeOCSP_request_onereq_get0EVP_CIPHER_CTX_get0_cipherEVP_MAC_CTX_get_mac_sizeOCSP_REQUEST_newX509_getm_notBeforeOPENSSL_DIR_endOSSL_CMP_CTX_set_transfer_cbOSSL_trace_beginCONF_modules_unloadOCSP_response_get1_basici2d_PKCS7_bio_streamTS_VERIFY_CTX_add_flagsOSSL_CMP_CTX_get_statusCRYPTO_mallocEVP_MD_gettable_ctx_paramsOSSL_STORE_findEVP_KEYEXCH_get0_descriptionBN_bn2decPKCS7_SIGNED_newASN1_PCTX_freeX509_REQ_sign_ctxASN1_item_unpackBIO_sock_should_retryOSSL_CMP_CTX_push1_subjectAltNameX509_get_pubkeyX509_OBJECT_get0_X509EVP_MAC_get0_descriptionEVP_PKEY_CTX_new_idEVP_MD_CTX_get_pkey_ctxX509_PURPOSE_get0OSSL_CMP_ITAV_new0_certProfileX509_time_adj_exOPENSSL_sk_shiftEVP_CIPHER_CTX_ctrlX509_STORE_CTX_set0_crlsX509_add_extENGINE_get_digest_engineOSSL_CMP_HDR_get0_transactionIDEVP_PKEY_CTX_get0_pkeyOSSL_STORE_INFO_get0_NAMEOSSL_PROVIDER_gettable_paramsi2a_ASN1_OBJECTX509_EXTENSION_freeNCONF_get_stringASN1_ENUMERATED_freeEVP_SKEY_get0_provider_nameX509_CRL_set1_lastUpdateOSSL_CMP_CTX_get0_untrustedOSSL_STORE_INFO_get0_PARAMSOPENSSL_asc2uniOCSP_response_status_strEVP_KEYEXCH_gettable_ctx_paramsEVP_SKEY_freeX509_ATTRIBUTE_get0_objectASN1_INTEGER_freeOSSL_STORE_eofEVP_PKEY_CTX_get_keygen_infoX509_CRL_add1_ext_i2dEVP_SKEYMGMT_do_all_providedTXT_DB_create_indexOCSP_id_get0_infoOSSL_DECODER_is_aASN1_STRING_print_exOSSL_CMP_CRLSTATUS_get0BIO_dump_indentEVP_SKEY_importBIO_debug_callback_exX509V3_add_valueEVP_MAC_get0_providerEVP_RAND_gettable_ctx_paramsX509_EXTENSION_get_objectX509_CRL_get0_signatured2i_PKCS8_PRIV_KEY_INFO_bioOSSL_CMP_SRV_CTX_get0_cmp_ctxEVP_PKEY_print_paramsX509_REQ_add1_attr_by_txtEVP_PKEY_print_publicEVP_RAND_get0_providerX509_chain_up_refX509_get0_extensionsBIO_s_connectEVP_PKEY_new_raw_private_keyBIO_sock_infoX509_REQ_set_subject_nameCMS_add1_recipientOSSL_CMP_ITAV_new_rootCaKeyUpdateOSSL_CMP_MSG_readOCSP_request_add1_nonceX509_STORE_set_flagsX509_STORE_add_certBIO_writeASN1_ENUMERATED_setEVP_PKEY_get_bn_paramBN_set_wordEVP_KDF_up_refTS_RESP_CTX_add_failure_infoOSSL_CMP_CTX_set1_untrustedPKCS7_verifyGENERAL_NAME_get0_valueASN1_TYPE_getCMS_data_create_exBIO_listenOCSP_basic_sign_ctxX509_NAME_ENTRY_get_dataERR_print_errorsTS_RESP_verify_responseOSSL_CMP_CTX_server_performEVP_RAND_CTX_get_paramsOSSL_STORE_LOADER_get0_schemeCMS_get0_SignerInfosBN_bn2hexUI_method_set_readerX509_NAME_delete_entryBIO_sock_initCMS_RecipientInfo_get0_pkey_ctxASN1_TIME_set_stringEVP_KDF_CTX_newEVP_CIPHER_get_modeOCSP_BASICRESP_newTS_VERIFY_CTX_newEVP_CIPHER_do_all_sortedX509_STORE_newPEM_read_bio_X509_CRLPKCS12_decrypt_skeyOPENSSL_sk_deep_copyi2t_ASN1_OBJECTOCSP_basic_add1_statusOSSL_CMP_CTX_push0_policyEVP_PKEY_verify_message_initPKCS5_pbe2_set_ivEVP_PKEY_is_aEVP_PKEY_get_idOCSP_REQUEST_add_extOSSL_CMP_CTX_snprint_PKIStatusEVP_DigestSignUpdateUI_construct_promptX509_CRL_get0_nextUpdateERR_peek_errorASN1_INTEGER_newOSSL_STORE_loadEVP_MAC_CTX_set_paramsASN1_TIME_compareX509_NAME_ENTRY_freed2i_PKCS8_bioX509_OBJECT_freeTS_CONF_set_tsa_nameBIO_set_tcp_ndelayBIO_popTS_REQ_set_policy_idX509_NAME_add_entryOPENSSL_uni2utf8ASN1_generate_nconfOSSL_STORE_expectOSSL_CMP_CTX_set1_serialNumberCRYPTO_zallocOSSL_PROVIDER_set_default_search_pathEVP_ASYM_CIPHER_up_refOSSL_STORE_LOADER_up_refEVP_MD_CTX_get1_mdOBJ_txt2nidOSSL_DECODER_get0_descriptionOSSL_CMP_CTX_get_certConf_cb_argEVP_KDF_is_aEVP_PKEY_paramgenX509_alias_get0OSSL_CMP_MSG_itEVP_PKEY_CTX_set1_idX509_verify_cert_error_stringX509_VERIFY_PARAM_set_hostflagsCMS_sign_receiptBIO_new_fileBIO_ADDRINFO_protocolOSSL_PROVIDER_get_paramsX509_REVOKED_add1_ext_i2dCMS_uncompressOBJ_sn2nidEVP_KEYMGMT_get0_providerOPENSSL_hexstr2bufOCSP_SINGLERESP_add1_ext_i2dOSSL_ENCODER_is_aBN_rshift1PEM_read_bio_NETSCAPE_CERT_SEQUENCEX509_STORE_set_lookup_crlsPKCS12_SAFEBAG_get0_bag_objOSSL_PARAM_BLD_push_BNOSSL_CMP_get1_crlUpdateOBJ_new_nidBN_bin2bnEVP_MD_CTX_newTS_RESP_set_tst_infoASN1_i2d_bioX509_NAME_print_ex_fpOSSL_CMP_CTX_get_optionBIO_s_memEVP_MD_settable_ctx_paramsENGINE_get_cipher_engineX509_VERIFY_PARAM_get0i2b_PublicKey_bioOSSL_CMP_CTX_set1_pkeyASYNC_WAIT_CTX_freeOSSL_STORE_INFO_get0_CRLBN_optionsEVP_KDF_get0_providerX509_STORE_add_crlX509_CRL_set_issuer_nameOSSL_STORE_INFO_get0_PKEYBIO_ADDR_service_stringX509_STORE_freeTS_STATUS_INFO_newX509_policy_tree_get0_user_policiesOSSL_ENCODER_settable_ctx_paramsEVP_PKEY_paramgen_initBIO_socket_nbioERR_print_errors_fpSRP_VBASE_get1_by_userX509_NAME_freeTXT_DB_readOSSL_LIB_CTX_load_configEVP_PKEY_CTX_set_kem_opEVP_PKEY_up_refNCONF_get_sectionEC_get_builtin_curvesOCSP_CERTID_freeOSSL_CMP_PKISI_freeX509_REVOKED_set_revocationDateOSSL_STORE_LOADER_set_openCRYPTO_strndupEVP_PKEY_decapsulate_initTS_RESP_get_tst_infoEVP_md5UI_method_get_readerBIO_ADDRINFO_addressEVP_KEYEXCH_settable_ctx_paramsOSSL_STORE_open_exX509_NAME_add_entry_by_txtOSSL_DECODER_settable_ctx_paramsASN1_GENERALIZEDTIME_newBN_mod_expEVP_SKEY_get0_key_idOCSP_copy_nonceEVP_DecryptFinal_exPKCS7_newEVP_PKEY_signi2d_X509_CRL_bioX509_REQ_print_exX509_set_serialNumberX509_sign_ctxOSSL_PARAM_BLD_freed2i_OCSP_REQUESTBIO_f_cipherOSSL_STORE_supports_searchEVP_MD_do_all_providedOSSL_PARAM_BLD_to_paramASN1_GENERALIZEDTIME_freeOSSL_CMP_ATAV_push1OCSP_response_createEVP_MAC_get0_nameOSSL_CRMF_ATTRIBUTETYPEANDVALUE_freeBIO_set_callback_exPKCS12_SAFEBAG_get0_safesEVP_KEYMGMT_get0_nameEVP_DigestSignX509_getm_notAfterBIO_f_base64X509_set_versionEVP_RAND_up_refPKCS12_unpack_p7encdataOSSL_CMP_SRV_CTX_newX509_get_subject_nameERR_error_string_nEVP_KDF_get0_nameENGINE_get_RANDSRP_VBASE_initX509_policy_tree_get0_policiesEVP_MD_get_typeOSSL_STORE_LOADER_set_closeSCT_validation_status_stringCRYPTO_clear_freePKCS12_SAFEBAG_get0_pkcs8X509_REQ_get0_pubkeyEVP_des_ede3_cbcOPENSSL_sk_new_nullEVP_PKEY_copy_parametersPEM_read_bio_Parameters_exPEM_read_bio_ParametersOSSL_STORE_LOADER_set_errorCMS_RecipientInfo_kemri_get0_kdf_algPKCS7_to_TS_TST_INFOEVP_PKEY_keygenDIST_POINT_freeOSSL_CMP_snprint_PKIStatusInfoENGINE_ctrl_cmd_stringOSSL_CMP_ATAV_get0_typeX509_email_freeEVP_SIGNATURE_gettable_ctx_paramsEVP_DigestSignFinalOPENSSL_strlcatENGINE_get_pkey_methsOSSL_CMP_CTX_set1_senderNoncePEM_write_bio_X509OPENSSL_sk_pushBIO_freeEVP_PKEY_CTX_ctrlEVP_KEYEXCH_do_all_providedX509_NAME_hash_oldX509_REVOKED_set_serialNumberEVP_CIPHER_get_flagsBIO_f_prefixEVP_PKEY_get_group_nameEVP_MD_fetchOSSL_STORE_INFO_get1_PUBKEYOCSP_request_add0_idENGINE_load_private_keyOSSL_CMP_HDR_get0_geninfo_ITAVsBIO_get_callback_argOSSL_PARAM_modifiedEVP_ASYM_CIPHER_settable_ctx_paramsEVP_PKEY_fromdataEVP_DigestVerifyInit_exPEM_write_bio_PUBKEYOSSL_STORE_LOADER_get0_descriptionSMIME_read_PKCS7_exOSSL_CMP_STATUSINFO_newEVP_Q_macOSSL_ENCODER_get0_propertiesEVP_DigestFinalXOFCMS_decrypt_set1_pkey_and_peerPKCS8_set0_pbeENGINE_get_RSAOSSL_CMP_CTX_get_http_cb_argX509_NAME_ENTRY_get_objectEVP_PKEY_get_default_digest_nameOSSL_CMP_CTX_get0_validatedSrvCertOSSL_STORE_register_loaderOSSL_DECODER_get0_propertiesOSSL_STORE_INFO_get1_CERTBIO_new_socketOCSP_resp_findX509_reject_clearASN1_INTEGER_getOPENSSL_uni2ascOSSL_CMP_ITAV_get0_certProfilePEM_read_bio_PKCS7BIO_f_mdPBMAC1_get1_pbkdf2_paramASN1_INTEGER_cmpPEM_read_bio_PKCS8BIO_test_flagsPEM_write_bio_PrivateKey_traditionalENGINE_set_defaultBIO_ADDR_dupPKCS12_SAFEBAG_get_bag_nidOSSL_STORE_LOADER_get0_engineEVP_PKEY_sign_message_initOSSL_DECODER_get0_nameOSSL_HTTP_transferX509_NAME_newX509_CRL_freeASN1_TIME_set_string_X509OBJ_nid2lnOSSL_PARAM_freeEVP_PKEY_CTX_set_dsa_paramgen_q_bitsOSSL_SELF_TEST_set_callbackASN1_TYPE_setEVP_KEYMGMT_freeOSSL_CMP_CTX_set_certConf_cb_argOSSL_CMP_CTX_set_transfer_cb_argOSSL_CMP_PKISI_newENGINE_register_all_completeEVP_MD_get_sizeEVP_SKEY_get0_skeymgmt_nameEVP_MAC_CTX_newEVP_sha1X509_get_ext_by_OBJEVP_MD_xofi2d_PKCS8_bioX509_CRL_set1_nextUpdatePEM_write_bio_X509_REQBIO_f_bufferEVP_RAND_do_all_providedASN1_item_i2dX509_INFO_freeCMS_ReceiptRequest_get0_valuesX509_LOOKUP_storeEVP_DigestVerifyUpdateTS_RESP_CTX_freeOPENSSL_strncasecmpOSSL_ENCODER_names_do_allEVP_CIPHER_CTX_get_block_sizeASN1_UTCTIME_freeUI_create_methodX509_CRL_get_ext_d2iOSSL_CMP_MSG_writeOSSL_ENCODER_CTX_set_cipherTS_CONF_set_certsEVP_DigestFinal_exUI_add_input_stringTS_CONF_set_ess_cert_id_chainOSSL_CMP_MSG_get0_certreq_publickeyEVP_ASYM_CIPHER_fetchX509_STORE_CTX_get1_chainCMS_finald2i_TS_RESP_bioBIO_s_fileNETSCAPE_SPKI_get_pubkeySMIME_write_CMSASN1_OCTET_STRING_newEVP_DigestEVP_SIGNATURE_get0_providerOSSL_CMP_CTX_set1_serverEVP_PKEY_dupUI_nullPBE2PARAM_freeOSSL_CMP_SRV_CTX_set_accept_raverifiedOSSL_CRMF_CERTID_get0_issuerPBKDF2PARAM_itX509_SIG_freeEVP_PKEY_checkPKCS12_SAFEBAG_set0_attrsOSSL_STORE_SEARCH_by_key_fingerprintOBJ_ln2nidEVP_KDF_CTX_set_paramsENGINE_get_digestsOSSL_CMP_CTX_set0_trustedStoreOBJ_nid2snEVP_KEM_fetchUI_freeTS_REQ_set_versionOSSL_CMP_CTX_set_http_cb_argOSSL_CMP_SRV_CTX_init_transSMIME_write_PKCS7BIO_ADDRINFO_socktypePEM_write_bio_RSA_PUBKEYOSSL_STORE_LOADER_is_aBIO_ADDR_freeEVP_MAC_finalNCONF_newOSSL_CMP_CTX_get0_newPkeyOSSL_CRMF_CERTTEMPLATE_fillEVP_KDF_settable_ctx_paramsOPENSSL_LH_newCMS_get0_signersOSSL_HTTP_adapt_proxyX509_REVOKED_newX509_check_hostPEM_read_bio_X509OPENSSL_sk_findTS_CONF_set_signer_keyX509_get_default_cert_dir_envBIO_int_ctrlEVP_SKEYMGMT_get0_imp_settable_paramsEVP_ASYM_CIPHER_freeNCONF_load_bioX509_load_httpEVP_DecryptInit_exBIO_new_mem_bufOSSL_CMP_CTX_set1_proxyTS_CONF_set_clock_precision_digitsX509_alias_set1TS_STATUS_INFO_set_statusOBJ_txt2objEVP_PKEY_set_utf8_string_paramX509_CRL_diffTS_VERIFY_CTX_freeOSSL_CMP_CTX_set1_extraCertsOutPEM_write_bio_PKCS7PEM_write_bio_PKCS8OSSL_CMP_MSG_get_bodytypeASN1_TIME_freeOSSL_CMP_MSG_freeX509_VERIFY_PARAM_get0_namePEM_read_bio_PKCS8_PRIV_KEY_INFOSRP_user_pwd_freePKCS7_freeX509_add_certOCSP_resp_find_statusPBKDF2PARAM_freeASN1_TIME_printOPENSSL_strlcpyEVP_CipherTS_CONF_set_digestsASN1_parse_dumpOSSL_CMP_get1_certReqTemplateOSSL_DECODER_names_do_allOSSL_CMP_CTX_set_serverPortEVP_PKEY_get_base_idX509_print_exX509_VERIFY_PARAM_add0_policyASYNC_WAIT_CTX_get_all_fdsENGINE_by_idEVP_KEM_up_refUI_method_set_writerTS_VERIFY_CTX_set0_storeEVP_CIPHER_get0_providerOCSP_REQUEST_freeX509_VERIFY_PARAM_set1TS_REQ_newOSSL_STORE_LOADER_do_all_providedUI_get0_user_dataEVP_SIGNATURE_settable_ctx_paramsEVP_PKEY_CTX_set1_rsa_keygen_pubexpEVP_PKEY_CTX_set_dh_paramgen_prime_lenOSSL_CMP_SRV_CTX_set_accept_unprotectedX509_NAME_onelinei2d_TS_RESP_bioTS_CONF_set_signer_digestEVP_KEYMGMT_gen_settable_paramsX509_get0_notBeforei2d_X509_REQ_bioOSSL_ENCODER_get0_descriptionNCONF_get_number_eOSSL_CMP_ITAV_createENGINE_get_pkey_asn1_meth_strSCRYPT_PARAMS_freeUI_get_string_typeEVP_DigestVerifyEVP_SKEYMGMT_names_do_allPEM_write_bio_PKCS8_PRIV_KEY_INFOOSSL_CMP_SRV_CTX_get0_custom_ctxERR_set_markX509_STORE_CTX_new_exEVP_CIPHER_gettable_ctx_paramsOSSL_CMP_print_to_bioOPENSSL_sk_new_reserveOSSL_STORE_INFO_type_stringBIO_new_fdX509_STORE_load_storeOSSL_PARAM_locate_constX509V3_extensions_printBIO_new_fpX509_check_private_keyTS_CONF_set_orderingASYNC_init_threadX509_REQ_verify_exUI_set_resultEVP_PKEY_get_bitsOSSL_CMP_CTX_set_http_cbOSSL_STORE_LOADER_set_eofPEM_write_bio_X509_CRLASN1_UTCTIME_newX509_NAME_cmpEVP_KEYEXCH_is_aX509_ALGOR_get0TXT_DB_writeOSSL_ENCODER_CTX_set_passphrase_uiEVP_PKEY_get_utf8_string_paramX509_NAME_hash_exX509_get0_signatureX509_VERIFY_PARAM_get_countEVP_PKEY_meth_get_countPKCS12_SAFEBAG_freeEVP_PKEY_verifyEVP_PKEY_CTX_set_cbEVP_KEYMGMT_get0_descriptionOSSL_CMP_HDR_get0_recipNonceEVP_DigestFinalX509v3_get_extOSSL_CRMF_MSG_get0_regCtrl_oldCertIDERR_set_debugEVP_MD_freeOCSP_cert_id_newEVP_CIPHER_CTX_rand_keyEVP_CipherInit_exEVP_KDF_get0_descriptionTS_CONF_set_serialEVP_KDF_names_do_allCMS_SignerInfo_get0_pkey_ctxEVP_MAC_freeX509_STORE_CTX_get_explicit_policyBUF_reverseEVP_PKEY_set_paramsTS_CONF_set_def_policyPKCS7_encrypt_exOCSP_RESPONSE_itTXT_DB_insertOBJ_cmpi2d_OCSP_RESPONSETS_CONF_set_policiesX509_CRL_add0_revokedUI_method_set_closerd2i_PrivateKeyEVP_PKEY_CTX_is_aX509_time_adjOSSL_CMP_ATAVS_freeASN1_PCTX_set_str_flagsEVP_CIPHER_get_iv_lengthNETSCAPE_SPKI_verifyX509_get0_serialNumberEVP_PKEY_print_privateOSSL_PROVIDER_get0_nameBIO_f_nbio_testPOLICYINFO_freeOBJ_create_objectsASN1_TIME_diffOSSL_CMP_CTX_get1_caPubsTS_MSG_IMPRINT_newASN1_PCTX_newCMS_set1_eContentTypeX509_REQ_get_extensionsNETSCAPE_SPKI_b64_decodeEVP_KEYMGMT_gettable_paramsOBJ_NAME_do_all_sortedX509_ATTRIBUTE_createEVP_PKEY_encapsulatePKCS12_freeBIO_s_acceptOSSL_STORE_INFO_new_PUBKEYPKCS12_SAFEBAG_get_nidEVP_CIPHER_freei2d_TS_REQ_bioCMS_get1_certsTS_MSG_IMPRINT_set_msgASN1_INTEGER_setX509_subject_name_hash_oldEVP_PKEY_set_int_paramOSSL_STORE_SEARCH_by_issuer_serialX509_REQ_set_versionOBJ_createTS_REQ_print_bioEVP_SKEYMGMT_get0_descriptionPEM_write_bio_PKCS7_streamX509_get_issuer_nameOSSL_CMP_MSG_update_transactionIDASN1_OCTET_STRING_cmpASN1_get_objectBN_CTX_freeEVP_SIGNATURE_freeENGINE_get_nameEVP_CipherInit_SKEYOSSL_STORE_LOADER_names_do_allPEM_write_bio_ParametersX509_add1_ext_i2dTXT_DB_freeX509_STORE_CTX_newOCSP_crl_reason_strEVP_read_pw_stringASN1_GENERALIZEDTIME_set_stringUI_method_get_writerX509V3_EXT_CRL_add_nconfASN1_TIME_print_exBIO_set_flagsEVP_KDF_CTX_freeOSSL_PARAM_allocate_from_textOSSL_STORE_INFO_get0_NAME_descriptionX509_LOOKUP_ctrl_exEVP_DigestInit_ex2PKCS12_set_pbmac1_pbkdf2X509_STORE_CTX_get_num_untrustedPKCS7_add_certificateEVP_KEM_freeBIO_number_writtenX509_VERIFY_PARAM_set1_emailEVP_KEM_get0_descriptionASN1_UTF8STRING_freeX509_get0_notAfterX509_STORE_CTX_get_current_certEVP_PKEY_CTX_ctrl_strGENERAL_NAME_printOSSL_CMP_CTX_newEVP_MAC_gettable_ctx_paramsTS_RESP_CTX_newCMS_final_digestOSSL_STORE_INFO_get1_CRLTS_RESP_get_tokenEVP_KEYEXCH_up_refEVP_KEYEXCH_fetchEVP_PKEY_get_sizeCMS_add0_recipient_passwordEVP_PKEY_decrypt_initBN_newCMS_RecipientInfo_kemri_get0_ctxOSSL_CMP_CTX_set1_no_proxyERR_clear_last_markEVP_DecryptUpdateX509_set_pubkeyPKCS5_pbe_setOSSL_CMP_exec_GENM_sesEVP_PKEY_encryptEVP_KDF_gettable_paramsCRYPTO_secure_malloc_initASN1_PCTX_set_flagsPKCS12_unpack_p7dataTS_RESP_newEVP_CIPHER_CTX_get_key_lengthBIO_ADDR_hostname_stringEVP_MAC_up_refEVP_SKEYMGMT_is_aOSSL_CMP_CTX_push0_geninfo_ITAVX509_get_serialNumberBIO_set_callback_argASN1_STRING_cmpBUF_MEM_growX509_printEVP_MD_get0_descriptionX509_STORE_get0_paramUI_OpenSSLX509_get1_ocspEVP_PKEY_CTX_set_dh_nidEVP_PKEY_set_octet_string_paramEVP_KEYMGMT_up_refTS_MSG_IMPRINT_freei2a_ASN1_INTEGERX509_get_extension_flagsEVP_CIPHER_get_key_lengthEVP_KEYMGMT_settable_paramsENGINE_freeX509_check_purposeBIO_newX509_VERIFY_PARAM_newOSSL_CMP_MSG_update_recipNonceOPENSSL_infoTS_TST_INFO_print_bioEVP_PKEY_CTX_set_dh_paramgen_generatorOCSP_request_signX509_VERIFY_PARAM_get0_hostEVP_PKEY_get0_type_nameOSSL_LIB_CTX_freeRAND_pollX509_PURPOSE_get0_snameEVP_CIPHER_fetchX509_set_issuer_nameOCSP_RESPONSE_printEVP_EncryptInit_exOPENSSL_LH_strhashEVP_KEM_names_do_allBN_bn2binENGINE_get_DSAX509_STORE_set_verify_cbOSSL_CMP_CTX_set1_secretValueEVP_CIPHER_settable_ctx_paramsBN_dec2bnPKCS7_print_ctxOPENSSL_sk_valueOSSL_STORE_INFO_get1_PARAMSEVP_PKEY_public_checkBIO_get_retry_reasonOCSP_REQUEST_printBIO_ADDRINFO_nextPEM_write_bioNETSCAPE_CERT_SEQUENCE_newEVP_RAND_get0_descriptionNETSCAPE_SPKI_newOSSL_ENCODER_get0_nameOSSL_DECODER_freeRAND_bytesEVP_PKEY_decryptEVP_get_digestbynameOSSL_CMP_get1_caCertsBN_generate_prime_exX509_issuer_name_hash_oldOSSL_PARAM_construct_size_tX509_CRL_sortOSSL_LIB_CTX_newOSSL_CMP_log_closeBN_randBUF_MEM_newPKCS7_finalTS_RESP_set_status_infoBN_GENCB_newOPENSSL_LH_insertEVP_RAND_get0_nameTS_CONF_set_crypto_deviceCMS_dataEVP_SKEYMGMT_get0_providerEVP_ASYM_CIPHER_get0_providerCRYPTO_callocOSSL_DECODER_CTX_new_for_pkeyEVP_SKEYMGMT_get0_gen_settable_paramsRAND_load_fileASN1_item_i2d_mem_bioX509_ALGOR_newEVP_ASYM_CIPHER_get0_nameTS_VERIFY_CTX_set0_certsEVP_CIPHER_CTX_set_key_lengthNCONF_get_section_namesEVP_MAC_names_do_allX509_LOOKUP_ctrlTS_RESP_freeEC_curve_nid2nistX509_REQ_newBIO_dumpENGINE_get_firstBIO_ADDR_rawportX509_cmp_timeOSSL_HTTP_parse_urlCONF_get1_default_config_fileX509_STORE_CTX_get_obj_by_subjectBIO_ctrlASN1_TIME_newOCSP_response_statusX509_CRL_sign_ctxOSSL_trace_endOSSL_CMP_ITAV_new_crlsCRYPTO_malloc_arrayX509_REQ_add1_attr_by_NIDX509_VERIFY_PARAM_set1_hostPEM_X509_INFO_read_bioX509_ATTRIBUTE_countEVP_get_cipherbynameOSSL_STORE_LOADER_set_loadEVP_PKEY_CTX_set_dsa_paramgen_bitsEVP_PKEY_derive_set_peerX509_REQ_check_private_keyOSSL_ENCODER_CTX_set_paramsEVP_PKEY_encrypt_initASYNC_is_capableUI_add_user_dataSCT_printOSSL_CMP_MSG_http_performNETSCAPE_SPKI_signASN1_OBJECT_freeEVP_SKEY_generateX509_gmtime_adjEVP_PKEY_verify_recoverOBJ_obj2txtEVP_KEM_do_all_providedOCSP_id_issuer_cmpX509V3_EXT_add_nconf_skEVP_PKEY_freeRAND_bytes_exGENERAL_NAMES_freeOPENSSL_sk_pop_freeEVP_KDF_deriveEVP_PKEY_asn1_get_countEVP_DigestUpdatePKCS12_create_ex2PKCS8_PRIV_KEY_INFO_freeEVP_aes_256_cbcd2i_ASN1_TYPEBIO_socketX509V3_conf_freeOCSP_RESPONSE_freeCMS_decrypt_set1_passwordX509_STORE_load_pathEVP_RAND_gettable_paramsBIO_parse_hostservTS_STATUS_INFO_freeOPENSSL_cleanseGENERAL_NAMES_newOSSL_STORE_LOADER_settable_ctx_paramsCMS_verify_receiptOSSL_PROVIDER_availableX509_STORE_CTX_freeENGINE_get_nexta2i_ASN1_INTEGERX509_VERIFY_PARAM_set1_ipX509_STORE_add_lookupX509_ALGOR_set0EVP_CIPHER_CTX_newEVP_CIPHER_up_refSRP_VBASE_newASYNC_start_jobEVP_KDF_freeCMS_ReceiptRequest_create0_exX509_STORE_CTX_set0_trusted_stackEVP_PKEY_meth_get0ERR_clear_errorCMS_digest_verifyOSSL_DECODER_fetchPKCS8_decryptNCONF_loadOSSL_CMP_MSG_dupCRYPTO_reallocEVP_MAC_settable_ctx_paramsEVP_PKEY_CTX_set_ec_paramgen_curve_nidTS_CONF_set_ess_cert_id_digestEVP_KEYMGMT_fetchCRYPTO_realloc_arrayEVP_PKEY_add1_attr_by_NIDTS_REQ_freeOSSL_CMP_CTX_set_optionBN_cmpASN1_ITEM_getOSSL_DECODER_from_bioOSSL_CMP_ITAV_get0_crlStatusListOSSL_CMP_ATAV_new_algIdOSSL_ENCODER_freeOSSL_CMP_ATAV_get0_algIdSRP_check_known_gN_paramCMS_decryptTS_CONF_set_accuracyBIO_s_nullPKCS5_PBKDF2_HMACEVP_CIPHER_gettable_paramsEVP_ASYM_CIPHER_do_all_providedASN1_OCTET_STRING_setEVP_PKEY_CTX_new_from_nameNETSCAPE_CERT_SEQUENCE_freeEVP_RAND_settable_ctx_paramsOCSP_basic_verifyOSSL_STORE_LOADER_set_expectX509_PURPOSE_get_idTS_VERIFY_CTX_set0_imprintEVP_ASYM_CIPHER_get0_descriptionX509_VERIFY_PARAM_set_flagsCMS_digest_create_exX509_delete_extOSSL_PROVIDER_loadTS_RESP_create_responseOSSL_CMP_SRV_CTX_freeOSSL_CMP_MSG_get0_headerX509_up_refX509_VERIFY_PARAM_clear_flagsBUF_MEM_freeOSSL_CMP_CTX_freeEVP_SIGNATURE_get0_namePKCS12_SAFEBAG_get0_p8infOPENSSL_sk_freeOSSL_DECODER_get0_providerPEM_read_bioX509_STORE_CTX_get_errorX509_STORE_CTX_print_verify_cbUI_ctrlASN1_item_printEVP_PKEY_CTX_newASN1_item_d2i_bioPOLICYINFO_newPEM_write_bio_PrivateKeyENGINE_get_DHCRYPTO_memcmpOCSP_REQUEST_itOSSL_STORE_attachOSSL_CRMF_CERTTEMPLATE_freeEVP_ASYM_CIPHER_gettable_ctx_paramsEVP_PKEY_asn1_get0_infoOSSL_CMP_CTX_build_cert_chainOPENSSL_strcasecmpASN1_item_i2d_bioENGINE_get_ECOPENSSL_LH_retrieved2i_X509_CRL_bioOSSL_PARAM_construct_utf8_ptrOSSL_CMP_ITAV_get0_rootCaCertX509_check_emailOSSL_trace_enabledCMS_ContentInfo_freeBIO_getsOCSP_RESPONSE_newX509_new_exRAND_get0_publicOCSP_BASICRESP_freePKCS12_set_macX509_VERIFY_PARAM_set_purposeCMS_ReceiptRequest_freeX509_VERIFY_PARAM_lookupASN1_UTCTIME_set_stringPEM_write_bio_X509_REQ_NEWEVP_KEYMGMT_do_all_providedCMS_EncryptedData_encrypt_exBN_check_primeX509_CRL_set_versionX509_REQ_add_extensionsEVP_PKEY_CTX_set_rsa_keygen_primesEVP_PKEY_get0_RSABIO_get_lineASN1_STRING_setEVP_MAC_initEVP_MD_CTX_freeUI_new_methodEVP_PKEY_param_checkX509_VERIFY_PARAM_get_flagsOSSL_CMP_CTX_set1_transactionIDEVP_PBE_findBIO_ADDRINFO_freeOSSL_PARAM_construct_utf8_stringUI_method_set_openerOSSL_CMP_CTX_get_transfer_cb_argEVP_PKEY_CTX_set_rsa_paddingPBE2PARAM_itEVP_PKEY_deriveTS_RESP_CTX_set_signer_digestEVP_CIPHER_CTX_freeX509V3_EXT_add_nconfOSSL_CMP_CTX_set1_certEVP_EncryptFinal_exX509_cmp_timeframeX509_NAME_add_entry_by_NIDEVP_KEYEXCH_get0_providerCONF_modules_loadX509_trust_clearOSSL_STORE_INFO_get0_CERTEVP_PKEY_CTX_set_rsa_keygen_bitsTS_RESP_CTX_set_status_infoBIO_snprintfPKCS12_SAFEBAG_get0_typeEVP_MD_get0_provideri2d_RSA_PUBKEY_bioASN1_d2i_bioPKCS12_verify_macOSSL_CMP_CTX_set1_p10CSRi2d_OSSL_CMP_ATAVSOSSL_STORE_INFO_get1_PKEYSMIME_read_CMS_exOCSP_check_nonceEVP_RAND_fetchSCRYPT_PARAMS_itEVP_KDF_fetchi2d_OCSP_REQUESTX509_VERIFY_PARAM_set_depthX509_REQ_freeEVP_CIPHER_get0_descriptionEVP_PKCS82PKEYEVP_DigestSignInitX509_VERIFY_PARAM_set1_ip_ascPEM_read_bio_CMSTS_REQ_set_msg_imprintOSSL_sleepOPENSSL_hexchar2intEVP_RAND_get_stateENGINE_get_ciphersCMS_sign_exBIO_closesocketASN1_STRING_lengthi2d_PKCS8_PRIV_KEY_INFO_bioOPENSSL_LH_doallX509_NAME_dupBN_CTX_newERR_pop_to_markTS_REQ_set_cert_reqX509_CRL_up_refCMS_add1_ReceiptRequestX509_SIG_get0EVP_KEM_gettable_ctx_paramsEVP_MAC_CTX_freeASN1_STRING_set_default_mask_ascNETSCAPE_SPKI_printX509_REQ_new_exX509_VERIFY_PARAM_freeX509_STORE_CTX_set_flagsEVP_KDF_do_all_providedX509_CRL_print_exOSSL_CMP_PKISI_dupPEM_write_bio_RSAPublicKeyOSSL_CMP_CTX_set0_newPkeyPKCS12_mac_presentOSSL_CMP_get1_rootCaKeyUpdateASN1_PRINTABLE_typeASN1_ENUMERATED_newOSSL_CMP_CTX_get1_extraCertsIni2d_PrivateKey_bioX509_NAME_print_exOSSL_CMP_ITAV_dupEVP_MAC_gettable_paramsTS_REQ_to_TS_VERIFY_CTXEVP_MAC_CTX_dupCMS_RecipientInfo_kemri_set_ukmOSSL_STORE_INFO_get0_PUBKEYEVP_KDF_gettable_ctx_paramsOSSL_STACK_OF_X509_freeOCSP_cert_to_idX509_get1_emailPKCS7_decrypti2d_ASN1_TYPEUI_get_input_flagsSRP_get_default_gNEVP_DigestSignInit_exOCSP_request_onereq_countCMS_ContentInfo_new_exBIO_vprintfOSSL_STORE_SEARCH_freed2i_CMS_bioEVP_BytesToKeyEVP_RAND_CTX_get0_randOSSL_PROVIDER_get_capabilitiesPEM_write_bio_NETSCAPE_CERT_SEQUENCEX509_CRL_new_exRAND_get0_privateEVP_PKEY_fromdata_initEVP_PKEY_CTX_new_from_pkeyOSSL_CMP_CTX_set1_serverPathOSSL_PARAM_BLD_newTS_CONF_get_tsa_sectionOSSL_STORE_INFO_new_PKEYOSSL_CMP_CTX_set1_subjectNamei2d_KeyParams_bioOSSL_ENCODER_CTX_freei2d_PKCS12_bioX509_get_exti2d_CMS_bio_streamX509_get_signature_nidEVP_sha512NETSCAPE_SPKI_set_pubkeyEVP_PKEY_CTX_settable_paramsOSSL_DECODER_up_refX509_PUBKEY_get0EVP_PKEY_derive_initOSSL_CMP_exec_RR_sesCMS_encrypt_exX509_PURPOSE_get0_nameX509_NAME_get_index_by_NIDEVP_PKEY_keygen_initENGINE_initCRYPTO_freeBN_freeBIO_ADDR_newX509at_add1_attrEVP_PKEY_CTX_set_app_dataEVP_KEYMGMT_is_aOSSL_CMP_SRV_CTX_set_send_unprotected_errorsUI_method_get_openerOSSL_CMP_CTX_set1_recipientTS_RESP_print_bioTS_CONF_set_signer_certX509_digest_sigOSSL_CMP_ITAV_new_caCertsX509_set0_distinguishing_idEVP_PKEY2PKCS8EVP_KEYMGMT_names_do_allEVP_KEM_get0_providerBIO_ADDR_rawaddressEVP_KEM_get0_nameOSSL_PARAM_set_all_unmodifiedd2i_PKCS7_bioX509_dupX509_STORE_CTX_get_error_depthBIO_accept_exOPENSSL_LH_set_thunksOSSL_CMP_exec_certreqEVP_MD_get0_nameOSSL_PROVIDER_do_allX509_verify_certOSSL_ENCODER_CTX_new_for_pkeyBIO_read_exOSSL_STORE_LOADER_freeBN_to_ASN1_INTEGERX509_REQ_get_subject_nameEVP_PKEY_CTX_get_app_dataOSSL_STORE_closeASN1_STRING_get0_dataOPENSSL_dieX509_NAME_get_entryBIO_new_dgramX509_get_ext_d2iOSSL_PROVIDER_unloadBIO_pushASN1_PCTX_set_nm_flagsOSSL_STORE_errorCMS_verifyX509_issuer_name_hashOSSL_CMP_CTX_set1_issuerTS_VERIFY_CTX_set0_dataX509_PURPOSE_get_by_snameX509V3_EXT_nconfOSSL_CMP_ATAV_new_rsaKeyLenBN_hex2bnOPENSSL_sk_newEVP_DigestVerifyInitOSSL_ENCODER_get0_providerASYNC_WAIT_CTX_newBIO_putsENGINE_ctrl_cmdENGINE_finishX509_ATTRIBUTE_get0_typesyslogfgetsstrcpylstatstdinsetsockoptperrorstrncpysysconfsymlink__ctype_toupper_locsetbuftimes__isoc23_strtoimaxstrspnstrrchrputcharunlinkfflushstrtodstrtok__isoc23_sscanfsetpgidforkstrlen__ctype_b_locstrstrwait__isoc23_strtolgetpidreadlinkstdoutisatty_exit__libc_start_mainstrncatstderrfdopenfprintf__isoc23_strtoumaxopenlograisemlockstrchrstrerrorkillgetenvfclosememset__isoc23_strtoulfputcrenamewaitpidsignalaccessmemcpyfilenofwriteselectstrcmpqsort__errno_locationabortpipefstatstrncmpalarmlibssl.so.3libcrypto.so.3libc.so.6OPENSSL_3.4.0OPENSSL_3.2.0OPENSSL_3.0.0GLIBC_2.33GLIBC_2.34GLIBC_2.38GLIBC_2.4OPENSSL_3.0.9OPENSSL_3.0.3OPENSSL_3.3.0OPENSSL_3.5.0OPENSSL_3.6.0                                  @ /pC -pQ +p_9Pm x ii *)+p#+p  .p  0p ‰ !pЉ /pC -pQ +p_  7        Ă  0 p  !  $ y( , 0 )4 8 < @ ,D H L P T 9X \ I` d h l p t x | > 7        t { + & S U    v       1          S  Q N     j$ ( _, o0 14 N8 =< e@ D 2H L eP T X  \ ` d oh Jl p Et x | d  "  )     t  3   \ x  ^   0  k       N 7   X t m    q    ]$ ( ,  0 $4 8 < @ {D H L P mT TX \ ` d wh l fp st x | "   h * $  u   #   A  D   " E   q   p Y   Z            p   $ ^( , n0 4 8 < @ D YH L P T mX P\ ` d h 'l p xt x |   \ c k      R  { E  .  i    6  g   ,  ,       E    { /    $ ( , 80 ;4 8 < @ D kH L /P T &X \ n` d Ah l p Vt x |         3 { # S    = # 0    !  n m n K W      3       -  3   $ ( , 0 !4 8 <  @ D @H L P  T @X \ ` d h l p vt x | [  o  o  ! d  ?  $ o 2 8 1    < '   3  (     h   Q 9       H  $ ( {, 0 )4 8 < @ VD }H L %P T 9X \ ` d .h |l p t yx <| )  $    ' t J     ^ b  8 p   2 f 8  [   ^  \   >     w   V R  $ ( , 0 4 M8 < 4@ HD DH L <P VT X *\ ` d _h l p t x | 8      t T   p J   n 4  W        \       c  d     | "   k$ ( , B0 4 8 < @ 0D OH bL P 4T X :\ ` id h l p t &x |  G 1 + h l  \   [ 4 I  - 5          z   a : 1   q Q  V '    "  c$ ( , 0 =4 38 w< c@ }D H L P OT X +\ y`  d  h l p t x |     o }         .    X j  _      * '  _  `   e   v  L  f$ ( c, 0 a4 8 < @ D H L P ~T X \ ` d fh 5l p t >x |   x  i     u "  ;   6 v 5    }  / ]   J W b     k   I L    q$ ( Y, 0 4 8 < 5@ #D H GL P T aX q\ ` jd h l p t x | P   0  F w        % X    - 8 J ~  r     @    (  % 1      $ Y( y, [0 l4 8 #< @ }D H yL |P T )X \ ` &d h l `p 9t Rx | g v  %  Z  2 (     #  9     l @ B   G    ;  U  <  u H    - $ ( B, 0 4 [8 < @ OD eH L P aT X \ ` d h Xl  p ?t x | T   K ?  6 r g     L      h    (  | G b  X   `     @ 6 '  .  $ ( , H0 4 8 h< L@ D H L P T RX \ A`  d rh Ml p |t Rx | u A 5  H a  Y     y ,  B   f  3   = m  .   x    ^  g        $ ( , T0 l4 8 L< ]@ D +H eL BP T X ,\ l` d \h l p At Ix |  r  -        7   O          2   ] )    r       s    $ ]( , 0 P4 8 < @ MD H L P T X \ ` /d Kh Yl +p t x N|           V  * q : :  i  C  F  _   l Z d  ;  w  b  7        $ ( g, 0 4 8 *<  @ D  H L P  T mX =\ |` d h l p t x !| .    Z 1 Y    m V q   I  H }      r   -    +   P     C  M  $ ( w, 0 4 P8 ,< @ ED (H ML P FT X \ ` Ad h /l p t >x | ~ '  D G  h D  ` @ `   T       L k  2     s z           Z   g  !$ ( 0, ;0 4 8 4< @ CD !H L QP T X ;\ ` zd h +l p .t Ex ,| K x 6  0     p  4 D      e : x   c   >     } 4     S      <    $  ( , t0 W4 8 < @ D H /L P zT xX P\ y` d h l p t px |            U %  @   d  * i  ? n 6  T   M X   ? F :     ^   \$ ( , 0 t4 98 ~< %@ D H L P *T X \ ` "d h l p t x |       u     9 i u      j   |     f        K :  O      Q$ ( K, 0 4 ~8 < @ D H L GP T X \ ` d h l p )t x |  W A f     b T a  N   C         F        S  ]   N  B g   `   #$ _( , 0 4 8 Q<  @ D hH L &P T X \  ` _d Ph l p ot ~x | z w  k  j l F  d    = J  7  C F b      s U B ]   ^ = -    Q   ( z  $ ( , 0 4 8 < ~@ UD H jL RP RT CX \ `  d h Dl Lp t x |   { ? S U   M $ G  v      (  u       U    $      J       $ <( , O0 4 8 $< @ D DH sL P T X \ [` rd h <l Cp t Wx >| W  i N   I /      &   z    8 K a    2 s s    `  7    [  5 >     $ ;( &, X0 4 58 6< j@ D HH L P T %X v\ ` d 7h Zl p t x |  n  ? S   c   d e  I  O   E Z@-I-g ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌG- MpyC*{6{PPV ``D` `V 0B?o 2R0S  xP`h#hX#P4kPP igiuPP  `0`SG 0B?o 2R0S> P l |FPp"0l|[ PjP D}Pn -`P ՒPtPh  PP XP!呛P R!XHP ĒXPp wPv tEP@ d@P; T;P6 D6_oR 41P* $,P% 'P "/o"0%X00S 凒U R  ;P: gPzm PR |lU  X h o q @v< @ , T}  L  p @s   --000-  0 0 R/ p@-@M&T' 0PQ 0P 0S (0S+ 0 0S$  ,0`S* 4000S4080/0 Ѝp1 / g:/Ѝp0`,PD LD : ( i:! < p@-@PTU Pp 2  p00S40SP, p g:p! < 0@-P MUQ@@P@T(( R  R 0P  P rPK Ѝ0x xx : Ѝ0D H g:1 $ :! < C-$M @`L QP VT00` (0PS  0. 0S Pj$h :hp$Ѝ]#[ g:[Pp # pPpU@P h3Py 60CPq 0Pd@@`P( ' 0@P "PP f0 @@ P JA2P0@ @P 0@ 0 0@@PCYQ  0 P PI 0P R^ ! : Q P`' `cP P Y@VPT!  : D@T nP DPt y w)[0 `:IP l8 @j :j`! < FĞ! O-MD@L`XP UT00V0S}p0( QQ 00S4Q S040 P  B/oY" R + 0S( 0P0 j5X   p0Q P0 0#00 :ЍS|P P  PX( P !P P P $P PppppD"LD g:Pl D0Ph P EP,  ЍO!: (@ p@p` PBfT1P 0PP@` pN Po|P@` p{Pn P,pP :P P . U S :SSIT pTG: GG?, L,= :<==5 ,! q< */T ]kYR@-@P 0,400,0  g:! < @-p4QM@(M`WW@ + \P! KTp/  BP;P0@p R@T0h$\ ۍЍLۍЍ80ꔅ l ` ̵  ܵ p@-MP`@sQP  Ѝp@  g:Ѝp@ " < p@-MP`VQPA (0@S1 0>0S+ 0% 0S" 0u0Q GP0 i g: gЍpS P$Ѝp@RL XLP :PЍpFj D g:D" <  p@-P@P U Pp>Pp%X # g:#(" < p@-P@P U Pp PpY  g:H" < p@-P@P U P Pp`  g:ph" < p@-P@P U P ? Ppp  g:p" < p@-@PP T @P @p  g:p" < p@-@kPP T @P @p  g:p" < p@-PN@P U bPpPpu s g:s" < p@-P0@P U DPppPpW U g:U# < p@-P@P U &Pp R Pp9 7 g:74# < @- MP`p@P  =0P $000$0 Ѝ  g: ЍX# < - M0P( Ѝ0 :g |# < - M0P Q0 ЍH H d:0 g: # < - M0P8 Ѝ0 :g # < 0@-MP5 P<}@P. P0$ U(  0 0 0 P  sP$0,0 PЍ0< 4Tp\$0Pp@-P /@P $uus,0  p@< O-P`9TM\)D04P8P`0FS<Ps 2VrpP `U``F ``TWd ) 8       %ZY R 00 `hPK P-d `V|q t5WP-Dd  (n  j000000 0 00000l  " t0 ,  ꔅ t % ?` EF( l W ] H < P Ȼ H ĺ l p@-P`0P@ p0 p蔅 , O-M$00`P  4080<0@0D0H0  >i@PF ~VZ0@P㰮導# 0S S 0R S SVDPU@p 0 S0P00 S0P0SsPy P0S==p@p0PH`-gVy.a)' Ѝ SP` h0 :00" (0B S0 0S ppGI@  W  0B^S W0R 00S0S00 i 0 Z0S^ 0Sy [SY;0P0 0S=X p`(p @upB pW[hP P@p  pP P`<PV 0 RP Ph0`}P V: hp@+PlP gP |bP $: hOPWPV ,p(pP#P P!  qwPP_p t9 #\YHZ 90[|U`,p(p@8Hx`0 @S90S1Z@Z2@P& OP  0S P -PPyP 0S W 0hP h00P IP 0S00h0 0G0S Q 0S 0  XP`W{  bPp 0SPPpVpAB0  PPO  YPH= P> '0S@01 H0S# 040S 0 pP,0 4VpPV O`!0SXB0SD<0  R(6 0LL0P L00YS `P}"iP %D}4`a 808x% 0p<0h40DPSP H0SM Dap0@ S`0`HPH y.t 0@Ѝ84k$4 e PpS0P0@p}3 @G 0em qP} zy00 Z0 ?7@ 00E0Cs0S|#|#1, u00RS0\#S Tj @cR <c 0R ] R W R QMؐHp "w"@PH17l00fQH |+|Ql&[ X!VTQL L 0 P   aP i 50  P) 0SV P aP 0SPO 0 h  0 t P P hP!,P40  Ȃ ` h% d p x r P D 8 , Ƚ Ⱦ ( P | (  0 d r x |  X ĺ   8 p % X x   D t Կ 8 l A-XM`1| u@PQe PpQ] RQm0S>| hPJ? L`0L00(00$00 0000000000 00000x000P00H00D00@000@<00800400,0'`XЍyP`#T `0 ]0$` P  G-`@pP8  1P@.@0TT$00P0VSP -P  "P E 00P L0  O-@XX"(pPe ,PP- ``, PG T` .P`W PY U @aP @ T1 `P!0DS_0 T`@Y@Z`P`PX!<X. `P PP1 T@@T`@X H0P( [$ 0`@0I0DP0 =l08X0p3D0 X-$0 @%`` % r% K  p 4 P O-@`GMC 0CS\ZP ` 䰍到lhdkhXPa V/6PP  ` 䰍到lhdj@\Z]0S -00 @ ` X 崈A?]lhdh Fcptl) id=xxyGݍ<Ѝ xxr:0olipf00c`00]hZWT00Oކ00Jن0|0EԆ0|0@φ :Ɇ 4Æ .꽆+꺆(08,0$00!000,00000p0S pYP `lhd(At0S tEPꅆꂆR/WP{0|000shQ/HPlS}]P eb_l\YV PM0|0ypg0P䚟d0 0S gP Xy d|)[P p`P 8d\Pt ` 䰍到lh0000C0KS@K}d&XcXP d(r[`P Pؙ 6P0Pt0f`0l0h0d00WC0Pp0E0 S<:11`d4(`I[P bh0S9 d(|@Pg gP |`P ` 䰍到lhmd'fP7'`ሀlh䀍Y |dX'[P LP @711l0S7 0S000 x 0 'l  wn`l[VR 0 S 0!0#00 R0S0dS 00&`1ZP 00YS0&0dX&,ZP 00YS0&0d(&Z`PU V\P01S d&ZP Z+\`P01 d%Z`P Ua\P |0 R00S d%0P0 &fPd%0P0 #gP6 0Y0 0p0RS0 0S}P p{0 -Rp0@0 S^`V o `V 00  h`0l``Z L4 0 0lP l`PW`r.QhP 0000&h@3@pABB@ BZ` 000 20@s /40P" 0<ß0ECQ p`E@ #TW h V0pS0R0E0p 28d"0Pl08 p2l0`001 ` 쒟到hd"PbĒ 2p ` ሠhl0吒`0h0p \ hE2`|`^/0Bb?`p``0Pp 10 !0. s g+01광 -``ꌑ$0`0l`h`Uꨅ l& v% DD ` H    l p |   [ @ t %   I 8 ( ( , ,  x Ȃ l  @X p h L <  p Lc 00.pem % ( x `-0D 0` y |  ☐,0Sk ^PQ0S 0S p` P0S0S wd1P6 0Sj0S] |0  1Q00S 00 0P ljP`( 0S 4aP Tj\PVj?”0Q|0Sv 0S? 0SU0SJ d"lXP |0000r0S `0 0`0W0 P 0S 0Sy 0Sf ĒH0SL PC \P? dW0P03 0P0* `V 010101X0( 10 $10P 1 ,?P 0P⠓0 000,a0 P@ p` R R ,0Bs0S 03 Rp041P41 Pc0P0    0!`Py +{GȔ`0ܔSw \`P P||pIK1$01` 0$1 P0 1[H0(1@01<00 00000100000p001D0d0800400l,000p(0L`00p0$ &w W|0|`0G 0Sj ` 娐  !PW6p0 0 i`P⨖a 0崖Sb(PS t ]aPJ \ 0PG @p$  ![P H !< (   !   p !D d 8 00004 l, L0 06pw8 W pW= 0 000`吐 0V0 00H0t00` 0p0D000100[T01L00@0d0<00800400,00(00$01 0000X00P0l0p` P [?p0p0W0 1`吐0!V00t0! 0p00001H000`T01DL00@0d0<00800400,00(00$01 0000X00P0l0p` P :T=P` P+ |00|0\ )000 ꠚ0 0|00 (00<<RPl {P |00|0,%:P& cP0|0I̛P6 EP |00|07`1`ht`P4ڠ0S|0| 0` 0 <  _|`E P |0U0YS`( 0S 0 $YP <3[P *O*0S0@=000|0000&-0 R-  [w wk@P `P 0SA &0S9 |00|0|0PD|p9`@P  000 S-P D0#2$500R00$50B 0@0L%c0SZH? d`pU@CP 0S /EYPF / [P`̟D|000S 0S `0 0`0bRdpb0 bj`P d,T0P0 0 Y0P|0 )E0 0 0S 0S~N`N_`Pe P nPc 00)E&nPV `娐夐嘰@00000S0'00RS@P} 000儐倐0^? CCpbp0P0[ PV `v PO  P 0 kP ڀpW 0 0`Pڄ0S0 0 0TP00 0.0PD OP( pW㼐 (`嘰.%i|0h0`嘰`嘰@0S)0 0S1 P,L|0h0>b?00  0`Td0Sw 0 dPj 0SmP 0S 0| WP |p0 l]P 0|(S wiP6 ~0S H(<WP 0S& 0S+ 8 00fP 0 S  0?P , %YP 'YP 7[@thhd\pOH`Jn4 LDt|Pn 0 X0|P``嘰8|0἖h0갖4T꜖/|0h0ꀖ{)E0 0sX`|0h0}d&W?dKSPdH&>DSPX0|`hf0|0H̕ \d%S0P0+꼀`Wꄕp`wP< $|0 WPM 0S P9 ؔ4d %Y?RP0Sd$R0S 0S 00~0S0S0St od$Rc ty^D`P2  Lo/d긓0fK0S `0 0`0dp0 P0H I.d#0P0 %d#0P0|jAP dj;PL3X0娒`,  x 3#AR2P8 d"2RP 0P00d"@0P0꼑 t0S XdH" R0P0td"#0P0 0$@80   a1 ̐`감 ]WP[ WPU 0S ` 0 H$o4 h`4 ` x \ L  ` t @  X 4 ( ( 0 @   D l 8 Ȃ  @ L , LP P h t x /O-MP@%Pu{p`e PPPP_~@P T!t@T@ Q~@P}`}PT0WV 4Pcp P`MD@DT'MPp@P`P4 @p`XWߍ{ 0000_ T@}XPp` 0SS\{p00|P J`J `P 0 {vPTCP@ 0|iP 0S]0SW 0S P} [ Pq a0P Xg RPYD Zn0S㈒1px *P ,@upW @ popP g4 S|$|0x |8,,L ,pnTZ N'q 0 P P @P Y XH@ p)uPA(g@ bĠP   ,p!R P pP 0S L0|$4 S|0 H|8,,XL@+ 0+ x D  \<8 p 0@- M0 000 Ѝ0蔅 0@- M0 000 Ѝ0蘅 p@-P @)Pp P MP JU P p  PpA-P`0p e@P lP V P00 ,Z_@Ԃ  l - P,M 0S 0$ P$ P0),Ѝ00S,Ѝ00Sڼ 0   0 |p D RϠ4 48 0$0( 0, K - t. 1 0 p@-PMU9 `@nPH@H r0@P0 SЍpS@ЍpϠ 000 00 P`Ѝp0 0 0h l0xP@00S8 LT@80 < , { . K R Il C-tC$M `VZ0Sp$ 4PPV 0S Ub  P0S  P&0 R 0P02 `z$Ѝ0PSU$0S0 (0S 20Sj 0 ( 0pp P0  0P0HP001`P,0S[ (0S 10SE 0$0Pp 0S  TP  P 0S? <<0PP`P$10SϠ 1 01!0 0 00000000?00 0 000000`00S`[Pd9ΠH0LD 0 0< 40PԂ l  , X K .  | H O-$MP Y o1 Up XB0S\W@B@2 R 0SckPn 0 lPh W`Aq .0S) S/ !SS 0S`<$Ѝ1 X0Sh! d1 0 X1X!0 P1P!PF`(P0S _P0 Z0 0>00`0 00$Wʛ0 0 0000000|0T00S0U0x0x4 <00`04 0X$0 ,  K o . { c g L A-pPM `U@E,V& "0`0  PUH(XJH10S78A ` 0\@ 1U\ @E H(X` 40`40@D`,VP 0`0  WЍPЍ(` `00X0X 0TT0P $@ 4n0@40,  Ԃ & .  0@-M4w0S -S@ Ѝ000Sڤ0P>x 0 00 T\00S@Ѝ0@0D@P$x4H400 8 @;, . ` 0Q p@-PP`pM B @X0P  {00pЍp0y0pЍp0/0P P i0S X00S00<<0< <0 0$ 0( (0( , K . @-(MvHhxX` y0P ISs0JS00 S'S].C BgR  wP ЍGPtW` pЍPIP/l,)h& 7 "700wЍ)uP6 ,u($ 01t0@?o &2 P0Sv 0S5% U0 05%>db`_\\XYTV0P1S0L1PHMDJt85PD0Sf5%, U0 05% Y0@10<-8*041'0$!}zwtq n kheb_\YV000000JGDAZt3Vtp3Rt`3P 0SH3H#` ,S0 0434#D plhd,01*t2(&t~01{01x01u01rosls1,hse01b01_x\0t0YVSP|MJGD|Asx>t;0$08052 /,0 0)&s0$"0p1}>C0CStP80S5X0Xx @P0 0 @0\ \'. Ԃ Df- ,  D , K ;   ; T C-$MC@CPP sI`|Q  gP P 4X0Pp {J }JX 1!SD R , X 00 \pfJWi 8Xa !R q W0 0]pHJWi 3Pd -2JP` H(PU .PO P 0(^P+ KpW# !R  W 00[p JW X !R8 l W 0T0[pIW X !R q W0 0\pIW P IP 6[P pW P 0@&#^P pW P 0&^P pW !R  6W 00&[pIW TX} !R X W 0D0 [pfIWi 8Xa !R  V 00ZpJIWM XE 4(p01S,0S S!R #!1P) 1S1S1S1S1S1S $Ѝ!R Px3p0SMʈ1S0SUQP$Ѝ!RT30SH3H#HH 0 0434#420S3"20 002020220Sڸ2"20 002020|2|2p"I>0L2|0 00\20@2($2$"T$ 0 02"40S!1 "0 0 1!0Sڰ1!10 001010t1!~rD0SqD1D!D 0 0010!lxc10S_0 L 0 00 ,fQ 7-.&" &1o?o2Q MPI iP 00S S d!R RSt l R  0CStX ԟ00졔 0 $LU0 p gZ G 0X0  WP* (!R81S <1S 0SSTЍD1S\1S0S}X]000CSk`Px$P 0S 0S`1S 00S 0S,1S 0S41S 0S01S 0S81S 0S<1S 0S0s 0Sv1S 00S L1S 0SP1S 0ST1S]X1SZ 0SW=-=0 0<0=0;0=&G 0S40Sڤ-˟0 = \-v\!RG $Q P$=@= 0=0<;-04$=00`1dSD QD \1Sv 0SP {P.  R00h0$ 0s S D1S 0Sڠ :RH;t9 0<;4+0`9 0`$;L*x0S 0S(9(ɟ*H:` `fd!Rd1S 0SFD1S, l0S 1S 0S1S  0S0sH1S 0S(:*0 0P9)09L0H80:1.70SϠ)` 9 4'DP 00S0Sp,1SU +P, 0 0005,!R 0,08P0S,PU8!R 0,0&P , P0q^ W 0S=ڈ(Ɵ8 @(/R0S-01 1S000S (lƟ8 T'P0S ڼ'ƟH7 t'`7`'k>0p70 0050`7 0!S R,',ǟ 0&7xt6&6`0 05060H506dT1S% 0S|6|&60 0t50P6040x6O͠\64&0 05$&06086?(1S 0S 6%0 045%05x0t405*0s 0S}ڸ5%0 04%0l50$405T5T%l50 00,5030T5001pWZ 0SWD1ST\1SQ1SN0,SU 060S 0,S   000== i 000P P  VP   uP)  R`!R81S3#30 02030|20373#3\0 020p30D2033\3\#t3$0 0T20030 20X3)3#430 02020103w2"20 01020102g2"2|0 010p20d102W\2\"t2D0 0T10020,10X2G@"@<2 !9Ԃ ,    0   { < FL;  t j (  T x BD /$ p   l H  o@ T 8T T* @ u    $   >   2  8 l; @ % \ L   |   0 H   8; l ~ H K  X; 0SU`1SR0\!R R Rڄ0 l00 0000100000 00 010001009W  0  `PL ^P /W CPXpjP 21!10 0010201ID1S 0S 1!10 00202015dQP D2<"0 00X2P"0,3,082# @P07 `V0Suژ2"0 2H# Pe 3%YpP_ KP0S3# 0 0(3X#:BP000SY P4HP9 YP M0S,ښ RD!R0S"#X3 ,$Q 0S0$044 x$h4$0 0@5$04L0P504<pDqlWp $0fU0PND1S.41 PS` 01S 0S] ?@1S <1S  507(0 00 807d~0S( 8 d( P` rs\qW 00S S )SYPO 0P0 SPgAU `9V PA0S0S_ڀ;+  0 0;+Q41S[^[50Sҿ!0S;+0 0, <,p0,0<4H,0 0 D<D,`p m0Sڈ,<,0 0 <,pO-@p/Mp 0P_ 4@8@<@p ^$@,TB \t <00@00800 40D @PQ D0t S Rn0Sx t $@P 80.p0S4<PTn0S@4H.g8<.c<0._ߍ.0Q \ P&=0SڇΠ?/ 0 0/(? 4=0S, ?dX |-0 >T/h4d00mS 0S[P @T% 0iS rR 0P 0cSL rRI R Eh0 P V,ad@P P ,Yd@P P |,Qd@P A00T S 0S0S 0S0S 0S0S 00S 1So 0S]ʼP 0+S@PS 0@_TJ @T+ P 0S00l0S 0S0@l0T PL 0<0P@D?T$ 0@T P *@PV *PQ 0SHP 0+S0P @PK 17P1S;L1S3 R  0RnRS$ 0S0 S0(0$ 0St0S x@|0T S )v0P H 40 0S$SK@P@ 0S0 4)dP  㪽xPK |0SH @0L 08H00L@00>RP HcH{X XL0~P bp$` e 0HYoP@ TbP@ @[ p0S0 iSP 0S0S BP' 0'R0P $`(p@`p%WH 0 -pPHp@᷿T@bTY A|K0 $0P@$'>>Tr P P0S  0QPZ 04 00 pD&40P 0Z0 0@ T ;@TP 0S K@P == A0@=T 0S  0Sʐ@T ( @P @T D쁕gK00 0P@=T P 0S Pc @0L 04H00L@00,QPv H@HiX0SʪL{f@BP] dQ %PV hQ XPO t$Q50 8/R4  #1D04 0P #^& c0S;8Ah1@ @@1l!0202,tAt1@ @2!01020@2 A1@ @@1!020|200S 0Sd2@",@ 0 02 #L4V bDp0P 0rS0rS0S  P  0S6ڼ2"0 0#x3@a(B2@ @@3(#0403R0SP E@T4 PF 0/o?o"2RW 0Sڀ#(4 #00S3# 0 04$44 0L%S] R0啾] LLYP@e0S`4$L 0 05$ll0S   0SSq 0S58%8 0 05@%40SL奼5000SxP |0SE5@ @@5t&060T6:E5@ @@5&0606#@T-R Q[(Xd 0`&6 M0SUh6pF(0l6,0,0@0(0 P7@0 @D7@o>0Sn 0S0&  |7 '[@4"0S 0SʰP 0'N@P 0@T :0ScP @P0Sڨ 7 h(0 l8'|$0S @0T S /0S$AT@0SD8|(| 0 09|(40S:0S70S4ڤ8(0 008L80X908% 9l)p%49I0,09) 0@ @@(D9 xP |0S0SA|I|9@ @@9)0:09 P 7@P0Soڬ 9  `*0 :*t4` !l t@PV lP  :?PL 0P {P  :?P; A0P jX p0 @00jH:@P `F0P P0S%`P p 坽P/@L 2LpT- 0S ,Sp,@P 0P  @P  eP 0SE 00j 0p g0P0@,fP 0L000QpP`  MP  Lpq<,0 00<<0(=0<0S0S@T  ` p@1S} W 0P P    P  5 `P pP^d@4rb0S=4.0 00$>D8>0P>0>0S t.0P L 00P L\,}0SCϠ>. 0 0.>n@45 "AP  ;P0S$ڨ ?@@@ 08/0?XO 0S0S^? 0 00h?Rt/? 0/?4?/0 00??0?0?%?p0 0?/?0?0H5S4T0L0 0S5% 0 04$A0St4$0 00440404e4$0 0044040X4LP4d$0 0L4tx00040`4044$H 0$ 03(üL唹3#0 00330303%0SxK @dPp `@0S]fCoqS$3,# 3\0x0 0|0020@302{0S2"0 02|0020202h0S,ځΠx2"0 0h2"P2W@40S<",2("0 0 2l"tpC4 0PS\p@P@ `1$">010 00101(0SQ@40PSX1`T! !0 0 01!Pp `q PR! 0\!\ 8!0H(0PSڤ0 0! 00 x0l0t 0 0X0 @0404 4 0 0 0p  K  ; \ ;  4 x  9  h  ;   Al  ( <$ ! H O-M`P[ OV`V 0`C` V0-SpP~02`` V800S P X 0S p>0X 0SVAP` 88 _P ` a`PO 8P°䍟}0`EP @PKpW[p m,p 8P.P p)P 4p8=GS0000].G}~GW Bpp$0R000-Q(I >0A5S-5S0 P080{ Pe Pn<80sl<X `0ԍ  .p.P P`; o0㫲05555555V P EP忲뭺U +Ѹt+l͸E?并Q Ѝ1P2 p1Sl1S0 0Q0P0  Q嫼P x0St0 S0St1S ,0S 0S` 0SS6`` 081 40 4 ! ? ! ? (" 8" d" x v  ~  r ( H l   l T H z\ p" '  b$ "  . (     Q  < L ;  =      x      S @ { 8! X H @> l! H K = !pA  p: 1S. m0P01   HpP+ QU` ?`+P+$  P0S0 `00ZP+1pP $0 $0$ Sk `'| Rz Rw Rt Rq RnSq 0S >018"0 001$8201t1S t0S] 0S`1" l#0 0 2"S0SZΠl!<2 T"0 X2"L$P$0S:0SL 0S7ژ2" $0 0 2P#*2d#0 0028d30D403}3#3d0 03030|40@3m0S 0ST3#h30 004030403X00S 0Sڨ3H$30 040L40503C 0 S ,0S 0S4$$4\0 0040p50L4*$0S 0S`4%t40 0050504P `HPLPPP `j \00VUdNPHV0H0x1YSPPPP\P咹L0P P0`00P H0PPP u< \0S PP0S Py&\P\U`0H L ($0 c 7PEP0PϯU L0S ትpԾ`}/l7PPH `o᫲ #t0S5ڠ6& '0 0 6X'(6& '0 0 6'} %Rꤷ[0X47'0 0<7L 1070`80l7bW,0S8e/H`3P0SP(决\dG0S0S 0S7' (0 0 8(9$0St1S lPP pD]P Rt8` 0(t9D0Sڠ8( )0 0 8X)  ;P7 )X^P 0S 9P0: 0<9*0 : 0P9QU> aP: F0S6 0Sڐ9P0d:( x I0hS対f9t*90 0:0x:0:0:0S (:(*0 004::0:0\: pNt0S ,pWt0@0:*0T; 08 : hh+K( :+0 00:;0;0$;t,;+0 0P00T;0;0`;e00S7=0;+0 00;<0;R a,ሲPP   D P0 SnH0S0 ´"PPm ,5p\` ( Ps *p兰W޸()뭹,P( Pᦱ S0P0 g0P p P 0 O\`PᡮP0_SN 0PSFE寸`ZV 0SPL=P0 0h=-0=0|=޿B0\00S? \{P| \P .,p$0Sq=-0 0040>0@>0 >庿b(?P`. 0S{ p|哽UL>H0> `0>P0.x>坿Sp0S>ڤ>.0 00>0>0>刿0>P0 0>/0?0 ?zMp 0Sp4?4/0 00T?d0h?0d?d 0SٶSP PF0Sڬ?/0 010?0?0?E>0?/0 0?10;0;5;+0 00;;0;0;&ts 0PLZpLJP r[  RX D} 0 + 0 0S%QU HpWb )`PL   嶴P0? S. pDЮH¼>0L:8:h*0\0` 00:0:˾0S:0*0 0:(0$:0 :09幾嵾9P0 09)90909妾S1ϴp0ST9P0 09)090$9叾0S'P 0S 0S8P0898) 0 900,908r>08P0 08(0|8dp8(0 00d8H8080<8UQUp 0SV8L(0 08 8080t807?F>07`0 07H(7@070SY0Sڀ7`0 07'070P7wH7`0 0x7'0707  S0\00SS Rk PU0R p7>0P0p< 0S 0S `pᓳlP 0S \0ܫPl \pWX `VS 0S@c뷺0P 0) 0 lP# 40&SSS  0S p u˭\ɭYPU+ 0S 06: p0&>P,U 0S0 0S:(5%0 00T50504儽,pP0S&4H%0 005t0p504p4X%4P0 0H50t40<50h4`,%X(m 0L SP \ C PU. 9 p0=P*,Up \``P0L pP L0Sd UM $LP;pLP\0S`3#0 00T3$83040,30S>03#0 00<3022P#0 00220302#PP #\p\0S 0S\2"0 00P2<420030(2м0S2"0 00220201徼 幼0Sp꣫01 `02"01020t1壼0S`1`0`2`" 01`0\20,1呼,1 `1$"02,010 200偼 p0S`V P ٹ0S 0Sp0`01 00000\0]T0 0 00H0hD00\10 0N`V \pW r @> {      X >  < K 0>  , ( . x =   >   \    H ;   o x   | d 0 @  , x s 8 q H  > x    @-@M,0+P TP2Ѝ A-M`p@#P#%P$ 0T 0T T 0 Ȼ别 0رP Ѝ"0 ⑫(0,嬻0 妻 (S S DS C- M`ḺpP! PP 0(@P P P PP ۫P Ѝ@p$Y &6 Ѝ@p@-PT埭`P@A@ᵫPၱpp G-tP ᦫP @` p<I姳(C@ᎫPꔅ l O-PKMp`PPPPP:P@Xɴ?`PP111 Q#XTl@`p?TPDPD,0C#S00 >CT& T]ND @DT%P@ p <<8,$(@ #`RP |00|0S0@0;TR40Pd0RC/MPl; h0@ p <8,$ h0(@ (h0m}QX7(h0h00e?h0b6h0_6h0\060X00x0TdQQ00N00K00HXQEUQBRQ?OQ,@p|0<8,O N0PH0%H0H0PP0P0t0@lX倧PPX|0@H U 0 ? \> ? FD U S    d `T T LU T T ( xW W DX XX X |T 8W XV V HT S 4V xU U V tS S S S ,T H Y H? d? X (Y dS V ,4Z Lq tX ,U  U T  U 00ʶ0h0P0S#00   h0S0(0 3P040Lh0妶0  z<00S0X0SeX40Y SR 4P00S <0QP0 2P 1h R0S p1s0 @0t <00S 1Pet0U【 1l]Y,0S 0" , ):P 2h Bo 0媢S00 S0RW0,0L 0"  6pP 3h R "h0S 00SI"hQ $ R8  0802`h0 0@ $0<) 0S 30@ h <@0@0t00S P3p3h R@040 010S DT0ZSZDP49  XZP P 0 Y6P p @ 4<8,04HPh0 = @0S [ 0t0#30 R<@0U4h R<0 0 D<04H0垵0HD044RY R50厵0 H 0 4 ,50僵0@0S01[1e t0#3,0S0@0h @05Bo᪢&0,00@ 400t0<@0<5@h0Nh SD0@p<080,0$0(00@00 0h0P\0P40Sd6050;60>046070-6(000&6@6@0M\ 07@0M 0 87@0M 0`7@0M 0,p0'   o50P,0% WE <0S 0080\0 0 8 0 060P 0 $0S\ p8h R0SRt0A=@SN$0P<0 0$00 0(P 1(S0P@0j 0(  0P0 (0Y !w80P0 89h RRo P9R~ R<8,04HN K/ tl@ p ><8,$(@ 7>h0@2ph0<8,$(@ ",0S ?h WBo , p @H?<8,S0[ 1}t?t00a 0S3 <080S_X  $0S r 0@<0$0(00@00h?l 0t 呧0P0/ x0S 0S@$8P @lpp|P>>h 8PRlpp|P@ 0S>h0@㟲 h0t :<Qk  屯ZP>Xh0@㗫 h0 `p >h RQ<0t ?o2"3Tt0ttl00 0勭0P0. L0S }P0SF P@ HP; P: Y 0p 'P> H, <)$=4h0M@ h0E<h0A@h09t0< C<!Rt0:t0HP @X<pⶥ%$Ϯ$噮0 Ĩ 1S/   嚫 UZ4  ᮨE! \XL3<h0߯h0g ٯ@ h0!R Rݨ٨娞įѨhp,@ p 3<8 @20 p ^(40P8TL@H0D< A@P Tt@T@@ ,>T0CT<PP>MD@DTP A@Px@Xo@PWPX0\S  RP V ll=P  8 X  R[ 00`0K(峞GP[00,d0 L0S0h 0" P 40s S0 ,d040wHn*0P00 D0SP<0SPUW T0pS 0,00  (pW x0P L0wP0H0 !PP D0S' 0L` D00x0*P YL@@  xLP@ YPL@0D x_.pxHW <0S l0S{ pp 8PPp@9( H40Y400P,P(P4@$9$)(y)h|0垔l/D ᢚ ᠚(l,c b0Ѝ= #PYg = ᣘPxZZ = ᚘPo=Dk=<h48<0e0L0b040_>`\H0|00x x0嫓P@p0P,P(Pt4?=p?=H<04097= / 1=.=0p80)=0p80T0#=0 0@00@0ߣP]ۣPY6( (0嶤(0Pp0P,P(PX|6(0婤(0`6PT6p0PI( ϣ06 S@Wd00d000&40 F580 40Pᄤp40+5 0050h0*&pKD0S x0PHpL0UPl5<0S= D0PH0uS x L pl 尔0p5x R 00#H014xH ,t0aPtl4$40>40x咠4 4044044 40)40<0x x0,x0L0:PlQ ` x儗P pP8p(,Nl`<V "0`H0W4<`P ` 88 L0`80V ;x3 40 40\0`C0<00 l(PD0080( 0400@000 ,ߑ<0X 0R<0OlP WxX0S3 0j(ɑH0SL 80 0"40 0@0( 00.0240喣40F< 8 `00x80 <pL<0< 8 `00x80 <pL<0L00FS0궠ald140c40PpH00800P0$04000`# p0D0 X40@400@409400(40240zlt040'40 xL0,;xDP`lHl 2HP/w L L   WD v w w E w x `( Lx  UNDEx |x x dS $y 8y x w x y y \y 0p@-M @000 0OP d IP@P1PѢ`P%ፘFDB Ѝp -P L0PP ZP  TP@0妢` GP E0P` @ ` @P wP0  ╛P0傢h ( } ? D} O-P<74M8'(0,0 P$P:pgPPPP=@P Tt@T@@ T6T PfTMD@DTt P ~=@P8<`/<V; @<P< X P X$0S Z8 0S f (. (   ᇙP  O50S EP&Z $ yPN  *P  $9PThe p Ր@ H “ A-4Ѝ 5 x:( w5Pr@<: ,pc:`:]:, \5PW l4 RPNLPJH00E00B$0SjʦSZ;Z$0Xmr( %PcE 0 0(0S00  ↛P nP(0S0#S; ᣓ P Zh D凜P 0P w, %0P 0Sn0SYUh,Q0"P  ᝕PPp CPl `UZ bCGtb0S TP ^hb՝PZ ᩠Po  )P  { W "Z200 $0  P> 0 0 `   QPM VTaPEڄ0 ᰔ d ? 0P 嵒`$٠` Ҡ`͠  ڛP|`张帠H`峠4`宠 `婠dO @O  H} } h D , = T= DHT} D}  L} } } t ~  h~ ~ ~ @~ ~ ~ L $ O-0pP@L&|MHH L08p <}Ѝ8TMD@DTCPG0CTڹP E6@P 5P %P XWB  P1 |P2 0 h(ℎP(0[0d@ 04(v(d0x@00S  0(g(0@0(♉(004P@ "pW 9PPǑP@P0S 0@ @BPJ L `PE $0S 0 0LQ  0S%0@ҎyP$ Z @D @@{ ȈP5 DⴒP0@L0LSH%0 D@嫎RP"DW003 %P 31P31P2p00002 22L -P@i4`p0 00$0 L`P ḓp ᰓW p P@胐3T@P# p U P@ X dpBHڙ`@ 3pBǙrBr@2 02H@P@f 0S  TmPv [ 4@ePB|埙\Al嚙0S X"X@SPg @ ݇0P2 P/ 候0@ <P\At4Z@0S9P!0@對WP@$@ Y@`vXOD1`0 0H@vP@|@ ;d@6L@0 @ &V V D ( h h 0  = T=   Ȋ  | 4 t ԋ Ћ t P x  8 : @ C- MP@p2U2`# iV)0H`h0V 0 P*@ 2V0 ЍD0D˜004 弘 Ѝ0嵘`ꔅ  A-P@ 000 ᰄ`P!2pݖD0P 8变 0S0 A凘兘pv O-P@oM`p@t@x@|@@}Pp vpPp+/00@00:Pppo(0@,@4@\@8@<@X@P@L@T@H@@@D@ @@}30P& Ss0S00 S, %.S  BSPPnP4=C0CSLP V30P2P 6P 40 0#R0S0t0.P tP M0>P 0h0d`0 0S x.P x0S ,0mS0,0(0OS00S1 [P0(000S=  0l 0 $H0S- r 0 S ?oL 2R0S^Z' wl TP P0SW 0LH0tpW Z <0TSU p P0 40St噏Ptq p0, x T垔PQ  m0 h$0Z T喈@0S  PtpJ PhD0S te DiPP& D70S Z:pP p0 gd0S UX 0@0@0 00000PPP \0SCP0S980S <0S t-PtP80S L_L`0S( H@0  00P *P;( ` P5L, 帍, R , j PPp$P P̅N͆ ݕ$/) 2 x忆t巕!|d)X oߍPIP 0< 0i,嵖PhP0n/Lak/T^h/H[0P0X0<0U0<0R0\0OM080JT/ @!DN/%.P 0S0À0:c07,0S040<8,00.0,40+5/ (2/@%//P"0t0)/D&/r'0P$0a $兌Z#ZZ  0 CRR  s R R t//$僑@P0$0$00kS0$ 00$0.-P1 0S(0-$0S 6( R&5(00p0X0080000000&S.@0S .傉Pf `0P0e @ H@P0 HP( H7@P 0 HPN  L刌P0  LP@8 [ 0t@x 0X帕[u(@5@%<0/B?1c0)0Wダ0l0 0 80S YR 0 tP D0 00$4QH@ $@t0$500 {P$ H@0SPpPz0`0h0dc0| P|WPpcNPp[FPp PP( :ꃒxBP h2Jb@- 0H)-P깊 P P0SX0S00SW  U 0LH0`  A> ÄLPp00T0 00 000 0PpP40SpPt弓0p I@0S Pf᱓h0P00SFD0Se@Pt@0SP PW LH 00S3 pP"80S  L_PL Y0P 垔N嚔)@P+呔A00S 劔兔傔, 4 0 X FX    8 D  8 P ' G h l *VUUU ԏ ( x L 8 L \ ` D < ` ̑ $ P [ T p , 4 dp*UM @0S0@0t3/ \  P p1各0@,0,0@,0冄tP ~}0@,0,0@,0stP k\*寃pߋTP  ᧂPPQ OPQ ,ᖓ40 4,0 ᎉZ. @ h0tR0S0p@40,囒0   40 ,嘈Pxt@?| ᫓劂t@4 ᠓TQ  唓s勓p0 儓4 H֊P 4ZPpH Ɋ0P dlph|ds҃0S,``P @ȃ APP,` 㼅t؍\tԍ@A-PM`@0S 0pv0P 0W*&ЍQʨ 0 Q0h H0 0P0J D800 H00P0, x 0@-@AMPዄ0P Aߍ00 ᘏ P Aߍ0蘖 O-AM/P=` ' Ȓ`ᦁY  |:p@PPD U!  ᡍ0  P 0P  p姒`YAߍ0  P  0嗒$AߍO葒AߍO茒 Ė Ԗ O-dMp៑@ᝑᛑ ZT00Y0S00QP P& HQ 0p-SpGP,*0x|0 000-PC P#pP + ÅP|ᡇ ះ ᝇ ᏁdЍ000 00 0 c0@R0d@P  * ចP| a,x{p{ l00,+pQᄅP Q 0-S{  OP z$p p (DPᝊ`\PP Ă 0ב ᵃێP0S 0SYx  0 Po 0 ݁`Pgΐ0P40] Y 0I?o2008,@8 0 ȁP|ڜ  0弁 P 0 崁PH喊@9 8們0S 它 媃0 0嗁`P+  0厁PB00@ T0 ST,@U4帆 x儃 h倃Ꮠ^$0% 00S0 0 ֐PD`H  (P P  'P P  'P PP  'P "P  x'P -~P= 0L 9/0P6,pp@ T, L0 y P@ $p(,Ƃ`ǁ 0ڐ &Ր}P^ ΐ (@,pᙐ0P 0L  '@Pe&P `Y``V6U*Z P ,嵋@P" 0HP~PN @t=0S<,00S? 6x0S, 0ShPQ  rT0P0P  <,0P 0> %@ zPl 0P_ @P<F  x`PD  x0P04 L00  `0PV  JyPP P00 0PI 0L`S ; 00P0P000P; +DP ۈP *:P| Pp 0Sm `❉@Ph0S`  *p}*`} ,0`V  `$;` @P<嚋 ````/} ᾁἁ庁y| |/ }V ф?{Mߍt90S`PH:$* pppph0d0Bz@00$9$8$PX )000X)000l)0 00X)0@00D)0000)000)000)000(000(000(000(000(000(000|(000h(0 00T(0@00@(000z,(000u(000p(0 00k'0@00f'000a'000\'000W'000R'000MXp'000F#(C}#@!@7 ;u#$8r# 5o#2l#%~P f# XyP0 0$ ^# <y0P00&0 000&0000X!0t&0000`x$P@ ````3#`D6P ````P6T%P0Z5 ,00, `V R- %`5$0?4,00P `5$T5$~P<$,5, 5|00x`$$(x3,00S$4P?($(0 0}P4 ,00Sp#\4@ PPP, P{ `P @@@@IP04 33L0ω08#(ʉ3(0ĉ0  l30廉00x0`^X30 Pᬉ0U43 0ᢉP0J3H3嘉@ h"P6 噆P2 D"P$ ⳃ`P 0 S[P p20s0 !`0{t!L{ ἂ,0`0V20[0`10S01p0L01X0E0`180<0} @P 4PY`ᄂ[,0`<1V ! 100] h] x Ě  w l T} T 56D 0 8 @ ܝ ĝ  T t x t \ 0  x ` T 0  ؟ ğ ؠ  p  x h \ H P @s `ՈP pЈP ˈP $ 0 ˆP 0` ``` P `P} H{Py~1 T0X0\0嚁0Pi ,000S0DT w0@080X w000\ vwBύ0000Dw0G0 06P ePiaP^B]PS X$w@ ax0@<"000(0S? w(L"y Y- 00P0 0 L0` %,0P@ T@262000 03x,0 0R#T2#3 0,0 0RDP<3T#P\0X3l#lX0t3#T0X v0@000v00 0~P30݇0O-P`@$M|PPhh# pTTcP"@P Tt@T@@ T3T[P2cMD@DTP "@P!PN !`P 6P  0Pw 2 0p2  d 0Po I~HbPlʁ`{ u`Pu EyPg0 P1 0   00|P10T0 1 0L0`'v@q} vyᕃ!h 4jy$Ѝg@s!` !] pWTPRPP000`@p0} 0 H0p00(0T000 a `    H} 'H D h (   p@-@MP 0ЍpP` BP 兆0S V0 GP0 0Ѝp  ~0yP0$@ $0宆uꔅ $ < O-P9LM`D0@8P 0P$0n $݁P0S 000  $y0S?{0S$`8pN0%Y$`0 0D  P 0 D  PP 8p<6k0P01G 5 , 5 (%n'yP5g$U bp_,\ YD .P pX( \勅z`et@Vwׁ@c t t%<w~LЍ0 h$Q0 |PP+ ~Ps@P pR0S Hlt  BR !!LR  @>0Sᑁz00Pzp@`zpᨳ`z ` p ሳPu 0Fu@u 0l@B$0Sp 0 $8pP 8pWc貟 0( s_IJ}s; vq`Bzᄲ8pQ  0 (sp` ̈́]HȄ74 l„R\} z0z ` -0  0P$0- D0!S- S  $MYP@P40S00V 000  ${0py `8|僄y$`y`<0 0$0@ PPyYP $Pw}0Sy$` $P0Sy0$`0_}0SgX}y$`8pyY$`ms0 b \b  H  D AЭ \ | t ج T (  ( H ` O-DM{@p|;WP`PP40,@0@8@ᠵ},^u0 Ys- d8/vrDЍH <%10,,E 0PP0Po SAs0 S0 4 Ӄ@ 4  4 n ~ jP1}0,u0吂s 8uDЍ$S S]>C 0CS=P},`u0or 8up#SPPP$0e@\Tn $mP P 0P 80Pm  0P~ X@R0 @,dPa 20Sd,qr4,9wPW {{PM ,|P_ ,K}Pz44 08, @P> 0SS80U0 0A 0 00_oR|~,et0 `r4 86uU\ 4P 40S S<)` L@@0߂@ ,o0PP ,x_oR͂0< <08r<P <wYP 0 Tt Dt<0|x孂 h娂\夂ꔅ į 0 dd Xd D DFv ԯ ( d  ̰  A-0!,Qp0P@` C P. `0P@yP# @DT'T+  0R f``?n```ox`t@ pLX@ XE@@ D? f f (  D 4 P O-PM%kpe PPV@P TT@DTX@ T  T 8P`\E P5T @E` 8` `p0@00  % Sw!}uu x t t t  tЍ00U KuP{ ` s@}U0  8 ,4,$@m~ 1u0PS Yu sk@|U0 pp3#@Q~u0P/ Wqo sO@|U0y XX3L#@5~t0P XUq7 Q4 eKB  0Bs aB  0Bs pY B  0Bs QG`>VJT`L n0P0Q `PJ U x, PK p0PQ 0"S w TP; Z= +0P 0+  0'sPO 0S@ w00'P0 P~ pP0 P[P0 P8PP$ `@@ @ @0 0@0ڀo   z0P0  ɀ@P@À<@x往`@` ``f Df ED h  0 \ < $ h ( 0/@-Ms@sЍ@}@-`PAM M\A( s H偀UJ }p`p$ vpY|s n wP0 !ev@P, P) `p@P" wP 00 Q Q  000CS0?  B!`rP rPAލ Ѝ蘅 | h ̵ 0@-sP@-MqDs@ q?sЍ@}G-@Ws}`P\ P㠁]   l9PxqYuPOpU>xQ lP 0/s@P  lP  pr 0S o P  q 6 C 0 ku *D|Gl}h0hG XPr  3 3 c $ H l  Ե 8@-MJ{r@E{rЍ@|G-rr|`PX xxou hx~PXqtPoU>xQ {P r@P  oP H {lr =0S xr P 3 n  l x v d$|GL}H0HG  3 3 c $ H l  Ե @-Mk)r@k$rЍ@|G-=r{`PX xx~ h x#~PXqCtP9oU>wQ kP r@P  sP ~m Wkq ~0S t P ~ m  5v x t d${GL{|H0HG~  3 3 c $ H l ġ Ե 0C-PQM`@C0 0C PU( (s@0SV# Vknl `}Py0S X P@U 0S 7} M~P@UЍInJ p{.y0SbX P@U 0S XrI V0 r@0oUQF0 ~P@X1 0VVn }x0S%YC @X 0S *vQ nP 0p@P  kP Z} i~p O}0S Qp P E} q  ?x  z D,zGl{h0hG'} X#}Pk  3 3 c $ H l  Ե L@-Mak1p@\k,pЍ@zG-tMDply`PQ ``| Pwm*|P@qJrP@mU6uQ |P p@P  ;yP |t ko m 0 |0S Is P || jr d#,yPЍGzD0DЍG| 0  3 3 c Զ l  Ե @-Myo@yoЍ@yG-tMolty`PQ ``q|w Pq{P@qqPlU6uQ zP o@P  tP J| yno { 0 ;|0S Zj P |1| pw d,$yPЍG zD0DЍG|  3 3 c Զ l x Ե @-Mt3o@t.oЍ@ yG-MFox` l1{Pq唁PqPFlUJtQ oiP L&o@P  8euP v${ R3 {{{{g Ktn {0S { ! u  *m |4xhЍG{yMt, {P  3 3 <8 , l H @-M {n@{nЍ@wx@-MXzn@SznЍ@gxO-lnhSxPZ Tlz@DqD p@kT9s`Q yP nP yP ,{  zPn !{0S gk P {Uy tHk `,xLxX0<Oz``  3 3 c l H <P 0@- ptT 0@-@ Mtu0P  R  Ѝ0 R DP @z00 Ѝ000Pz0` <8 @-Mxm@xmЍ@wO-lmhwP Tfy@DqD p@jT9Qs`Q gP mP hP z , xm vz0S hg P kzmj t8o `,XwL@xX0<ORz    3 3 c l H LP @-Mnim@ndmЍ@@wO-l}mh,wP3 T`jgy@DqD o@|jT9r`Q :oP \mP hP z  Yn)m y0S o P ym tbk `\,vLwX0<Oy  3 3 c l H P @-M~vl@yvlЍ@vO-lmhvP Tox@DqD o@jT9Yr`Q uP lP rP y 4 >vl ~y0S t P syt tp `,`vLHwX0<OZy  3 3 c l H P @-MKrql@FrllЍ@HvG-XlT4v`PL HH1y7 8hkxP(qnPiU2qQ sP al@P  mfP  y  r.l x0S \h P tx Oh \h$uGDv@0@Gx$ x  3 3 c l  Ե p@-M`@PSh>ilPsU ejPЍp5lPЍp@e0@-P0@S M P 04spP-s L Ѝ0@x Ѝ0P0R0 0Q   Ѝ0@xꈅ p@-M`@PvhuPbsU ZhuPЍpkPЍp@Khp@-M`@]_PYtheP>sU sFnPЍpkPЍp@psp@-M`@9;P rhfPsU SfkPЍpЍp@pp@-M`@Prh wPrU vsPЍp|kPЍp@vp@-M`@PhahmPrU euPЍpXkPЍp@ ep@-M`@Ps=htPrU rkPЍp4kPЍp@ rp@-M`@PxqhoPrU khhPЍpkPЍp@kp@-M`@P?wg?fPjrU \gjPЍpЍp@ip@-M`@ikPfgpPJrU e>fPЍpjPЍp@ep@-M`@EGP2mg%lP&rU gdPЍpjPЍp@rgp@-M`@!#PbjgqPrU pufPЍpjPЍp@aup@-M`@PdigvPqU klPЍp`jPЍp@kp@-@P[tPpQjPpp@vvp@-P@Qf`Nf1nPpriPrip@sP @-@t4 @v$R0 0Q  v꠷ 0/0/0/0/0/0/0/0/0/0/0/0/0/0/O-PTMP/P?D 0PP0P` #Sws0$S00 ` .hVX? LvЍY`}0P0DP 0$0 0up@ 0UW 0x0d-v\X(vH$#vv)(vivvvU v v vuX xul dgj _Zf| ZTH P~ u\ -iXr0P08 ~Du@4 iu,`(`'fXn0@S He,mPAe uqh, u0S r P xua ` k L g 8 `TD`WA0`W0 9 0S00 %\T; 0zSN J %\ 0DzSH D 0S00  0S   0S00  0Sz ]@ 0S00  0zS^ Z 0S zO- &,M mPpe PPP @P T T@DTg@ 0 0 T  T oP`E 5T pE` d2o`^@0 @%l 0Za $Vad KeIe j`D],Ѝy EaQjU@ 0$04k|b0P5 XU kbP 4a&jU@ p0$04kQb0P WsF 0C`pF 0C`P~ ` e]0P0b xgP [ U d`P[ Q[PZ q rPN 0"S w`P= 0  'mP `@` PF .gPs 0  \0P  \P4*  e PB 4P`\n;]'tmP PIompP PojmPP[ `AA Cn`A A:n] `0 $ P@`aP3 $0 S5:  $ aP) 0$ S/R @PJ @ n$ BQ P@ 0Sn@P`mt@m`@mL@m d`,@`Xk w DPk ED t  0  \ 4 C-|" MPp@db0P Ss0S0 =C0CSPP@` P P1 m@`c\b ЍTPQ@P`@r p!0P wT!`P< T! =aPP lP`P 0 k0P0]P% p 0Um4\0 ]PPp f&ep]PʝP@f@(@ 0 ,+m \@l l D  O-K?P`@/wM`1pT!$Q(Q,Q0Q4Q8QC0CS,P 000+S lh; S@P`` QܫPLd*2^*|`.^G/ll*^ U?0>0  S?WY_`Pz L1d0P1`0T1l0 kt0;t0}t00t0y0|0v0|0spmp00pa #bi0 RXpNcG`VP `ذ@Vnb 1^pgP @(^`Y@YT [?ذ$X 0 l!b@P+ gP !hpPB qb0-ZT!@\[Z V T 00VS RSK [Y0 Spae]`Pw 40!0Z0YPo @XGLc ̺mn m pm D DT I $   H h (\ 4Z | 8 4 \ |   x (  8  <  aPhQP@ ^YTt 1 h \P 0S[@ fddVT $Y 0PWV  P1@^0S  wPP)  ^^1[PP0S$QUv v `FV PX0$QV0QbXJP` MUP0+Ph`[ggp|0SOZu 2X00  0PP0 0S 2N/00UP @20 0@%0PL0 0 8!P 0L _PF`@@p\hp0`@W, !]p' P 1RX 1R  1R 1RP YPP P 4g0Af0 0<0@03 00I?0P 0AT|S:  rWpP 0 4c0O]01SЧ$gC`0ta100]/_?^xa|aMw0 000x101ZP5 |1S*  0`]t!\xb|XP1S<0z40ST0Sh0@0 0h040<0}00S  rPP} 0 HH b@\Tdf`p0`@`D f\`p0`P`4`L`@`H`0Sh0<0@0m>0@؀` ^ff0 (Up$`]SP @`TF_ [@gd0OowVB`VV [?U 0 l_`P  sdP!/eጡ_-W +` XT V# 00VS* RS3 @V [@؀`p +eP+ I`000 00@Z000 00`Y00000 0Y@0tA100]/_?^xA|AJv0 000x101YPM |1S9  0@\t![xa|W X萍@쐍 e0TX@ eh`t!R ,0\t!paW@t!R t0z\t!`t|e@؀`V `PP@@pe Rp `0@pl SRSS L0S0h0@0F8QBPW@PP`` tuep0`P`L`H`@0>圮 fel```d`!D0`̮[eVeQ`p0@@@y@p`p00r0@pSp` 0Pi0 00000P00 0S0S 0/ O/P SpP 0S0P #_Pp00 <YT P00R0SPڔeP01S `1\p0d1t0WUP 8SUPH@8|'cP ptT  d]|W]1S ]W]p1Stp W d]xW|] 8UXd8m]\i]L d=0_?0^? 0]?.u]P]0@p`p 00H`@pp0`@pd0`p00<0@pxdPp`0pV@U=wP10S 0h0@0@p`p0!i^@p0p `z0+wuGd&SP@<0 TXPc]37d`p0d,`pTh'dPX2]S4 p , 4 < h T  P C-,MP`\p@ bPwQX0TPL | 0 H0`@0PP UP,ЍMTE^@P,0,cP0c < //// Rm\0Q@@-P0$MS* 00`p00000T@P 0S 0`!S ! Pc H `P $1,c03/$Ѝc$ЍPP 0 0 @c/0}cOP 0 0 0nS0oS0-S  S80P0 D  Zc 0,Tcꔅ M (  з 0 SN`C/0@-P MQ & @0 S" 0 R0 x0pRpp1Rll0l lXP 0S ,@dU0 S@ Ѝ0ꔅ  [YYYYYY@-!MCP6@P t T>Ѝ1 bЍP= PR h wT1 TbH10S`@Q: 0R $ b`1V( V0 0 b0P0S 00 pQ@b0S` 0 0@c lb@080XbLb@0 8b\t D    Ԡ H O-4M@p]0df0] P N^ J^]U) t PUw) P) P) P]Pg0RY@Pb J[ UP^ aPX U  laPP   aPJ  <aPD aP> (YPP; [ UP5 paP/ jaP) daP#  TP Y`P @T   PaP@D@P <XP4.]P(P@Py/T__4Ѝ @ .aPP 0 `P@ M !aP @@P  SP p@!#!'`3! bR9V   aP'  SP! @T8 Z UP 0   ``P !"$2( R `P@`P@ `P  `P Y 0f_d_$ &`,p1<' P 0&%Q'-@<$!?@ @0@.@*@,%$<,?  0 $Œ@?ppp ."`#P)p(p./@@< .? + 0'&a x <,? `  %Q 0 (? )300ꬅ t t $I$UUUUO-M@1PP`CuSV00 Qpf [P< W?    ?     ?     ?     ?     ?     ?     ?    /  ?     ?    ?    ?    ?    ?    ?     ? 000 0 [ P0S 01VP1S [1S  X@`6p`j ]OpP  \$P P\Po[\j| ,PN| N| xN$:0|  N W[pPPPWPP tS0P \_0P  V_0P VPP `SP H_P  B_P <_P 8QP Rs*p` P` @V* 8$_P@D@P0m8P 9 00#0 0x_Ѝd_0 H_ xWxP0$SSP!Ϡ38\ 1! j[$P d[Zg| ,pM| M| M0P'x&\| xM| MPI \ P 0d 0P0U] S]'Q '{Q/wQ 6,;_\ `5p`f0P@P00 8`|^PP@ p`P @& 8n^P @@P` 8QP oRP Zp` @@T O^P@  G^P @@` xPP / XZ\0P p R*`Px Y GRp0: P` xY *RP8000!  ^0P^ 00S0 xPP $x"\0P   xp0Y`@`/Q:0S 8 ]P$ 8PP 0@T- QP 0  80]P Q  ]P0@ 8]P/ ZM ; ]P``S\ Q\$#}P#yPY08 6S$000@BLM( $ R?"#^9 ($C ? "#PN D$(: T? "#QE ;$(O ? "#P< P$(F ? "#QQ G$(= ? "#PH >$(R d? "#Q? S$(I !(? "#PT J$(@ %? "#QK A$(U )? "#P,5?   #3 Q0 00@J $u ؅ T} < ɚ;0   t $b p?PPP"#P ^c N$(9 Xp?PPP"#P\: d$ (O p?PPP"#P ^P ;$(e p?PPP"#P\f Q$ (<  q?PPP"#P ^= g$(R Hq?PPP"#P\S >$ (h q?PPP"#P ^i T$(? !q?PPP"#P\@ j$ (U %q?PPP"#P ^V A$(k )8r?PPP"#P\l W$ ( -pR?"# ^C m$(X 1R?"#\Y D$ (n 5R?"# Po Z$(E 9$S?"#\F p$ ([ =`S?"# P\ G$(q AS?"#\r ]$ (H ES?"# PI s$(^ IT?"#\_ J$ (t MPT?"# Pu `$(K QT?"#\$vU(a ?"# Pw W?"# UV O-M@P0PS V-P $00S0 , X ! 30 iUp `H p@0S 0 ` @ 04 P p@`4PP2 [@p`"MK/MQڍ<Ѝz0XXX|XxXtV`poV[`$iP@p``^00[0(0Xr$!`Pi U,p\ ! RP4 ZP 00 0 0000 04 00P@ 8ZP*8QPP 0 0000 04 000kP U4PvP=B(0 00#p5QP Pp@T0 t'[` p @4PZ`@W44%p,u t  D + P h D @- QM  @ M0 4 0Z V PGЍC-$M0 $NsT\B`PsYP ZV0 SPTT0P P0G ZPS SS$ЍPR~T0PP 0 M:T 0M2Tp `2Y%Q 0HZEY 81Y& \G0SPwSOT0PP 0Sp M Tp`FP 0oZM0SPCN+TPP `Y FFp F0 0pOZQꔅ <8 8 T ` x p@-P`@MP@ 0 XPT@pTSpp@-P d0B@PMS0 DPЍp@Z 0S P0`CPE ZVPЍp@Z 0SP0`CPE YUSXP P P0P gK 0 YlYPЍp d0 PЍp@Y0dQP 8Y, ,PЍp@Lv  G-QF `@JP : Yp JYXPYpJW&ZRPWJ(S@YT $X YXP @IW@XT,zY vY萶  D l , ,  C-PM@p`LOH3@P 80p#M@R@00<0 08000P@ ITa8080p["lT@pP`P VW"`<000@ ppsN@JЍ80t806MP80 .("?uSP&qP`PY P@I80aT!%Xp0MJXtU@Ѝ80F800@! K@P! P`P V !aK<00@ 0PX@UIXJK@Ѝ0XXh0X5T0pXR@0`XL Gt w ` p T O-MP@8`pD0` \SG0WS0RSX0S P LP a0@H0 aL9S@ H0  G ? 0S GdFLP )`# @`P NN RK PPF P0SP ` a S@ HLzNG0@(bH0BT0S `2 0,0 GP 0p"HPz 2`Rdb@ H OP 0 G0G0G GT? b0GFKCKLP P  > \R `P gQP0 aQ0 RX+{NQ0#HPG 3R@ `3iAc$R BP[`  2K =P/` BPdd\ hgRkO 0$bHPy000  C x0$ C@dH+"N aF B >Z T0SX0SeP)RX&R@m040 00 0 0D:?P-`eR`IP0& 40P> 4R040H>08P8 04Q 0S G-E|K`tH< Q MEXQ4fdQD@P QMET lf@D Q  tO`P>6P"  0GN`P' WE0`'C  [OP& ,QP0S`,gt HQvD7XQTXGhQpQ@MET0S X0S5Q_@g\ xQR/p@-`@AP  mQTp O-P5$M`@00Pf %phePPP@P7 T!t@ T@@  P@`5 5Q>`]G@$ЍMD@DTOP@` pO@PP r ;`P  NKPW 0SB 0 EXD w #PL 0S60SIZ0S KO0S P00 kP|@@`00q00n H0 HBP?@BP?@o0JP0 Sg0Sd  0Rt Z@@`6 0S[UJ P @I4IP @U[ P @ .I`ᘾ <yIP@U ` @+V* BHhI @ PR  I0PS D I,OIP @UD0P@~P  HD4IP @US ZP H@: <>PIP c@P @[`@{ { D u O-@EMX9 MT)D04@8@<@@@H@L@P@T@$;pP`0 @(@,@$@ 0PA S2s0S00 T`PH OpPm= ]B A4N? E8a/LA<D(<AEލ Ѝ,(ST=C0CSP 0PP P Z 8 H!P  (<0P w @ |7R r$0P U@L7 QQ00R SQoDpY F0P  ,DPP D0&SL S4 K BSlPi@fc(`]L0p 0GP 40SO@4LLpPH FP 0 OS<PPJ P0S4FLvPA L0S+=HmP8 H0S"4 0P00 0,$ ` D yP@ rPPp00P8A40SG@4DSNQBKpW 8X I zJMh4 0$80`W0PI }I0P  ,DPp 0SR D0#S S 3Np P3NCP@ 0xN3sN pP0 @pD3\cNpP0 EppBNN-=P BEN$=P 4T0P HQ L\ P^o p E@T| h@P0P3 r4"TpP2 ,&0 G0PV w!CPPZ [L Xe  ;@Th e7PSK0SI V 0  >` t1 pJ@`PpDG <?:A Ѝ `@PpP`00 @@J9` P @@` F``hJ9 `걲@᫲  8@0 `94 (  D | 0@- Q P 0@ @Q  Q 0@`7 Q  Q 0@ @  0@G 0@"A 0@|@0 @ 0@@ 0@9O-BMM`p|倠儠删匠吠`d/0p pppo4$0Pw  ,dS@0T00$S? Y W @W W. H0S.@0Sr $`=>0)V     @`P > >EP @|>p y> 0$H:4 H`,`G0P0G0P0ꌉ4 Hh(`0`$`,`(0S @0S WS W  G/o;G";S R` $0SM 숟(mH$0S000Z 4 dH`0S 8P,p$`p@8pX  AᖾPH 04 BH @,p80S `80P,p8@@p@$0 0P{  dEP.P:W @:tG`P 0&D0 >P@f/(hGP 8 ANd 0K9P L0YX >0P(0 h0l00ht0P ,=PN 0S G0$T00005 0(0~oo0bp%09$0S``V  Rh50 0(<`P D0`oo00bk8$Cą4 G`0%00 ( ~oo0b,p8@@H0S W``pSX;G;S0,80J wPP :G?o2 [00S[  wP HP 9`P T0 l0`40=V t0, R00SYklX Wb <P) 0S :G:S`X0 S`0S  6 R$ [   =03B`Ph4 G(`$`,` 2 R9FS80S L0S 44 F(AWs WL0d08 (`E0"9Ă|00S: CDT 0d/50$ꈂ4 F W^  WO 6F000S 'DTQ 70$(0F(0`00,聟4 \F$#4y8X?ʰꨁ4 Fꐁ4 Fh0(t0l0h,<PP, F0d08 (`AD0,<Pꄂ l 4 D abc p 4 (    P dS v P UNDE ( d 0 |  X 8 ( 4 D  h (  T  @  X t  \` rYV, :P080 080,0S/ GoP0娂S00S [, `㐀4  F관@ ,FÙ4 0DEL!.8N0;Pl14 0tE`(4 E< wPYPz ` ` Wd 0( -7P h0Sdh/8뤁` W >ȁp$(>U040f4 LE,`600 E, |ⴻPML0S 0`H| F| 0SYl0SE @XA Ă@0E `w ,=D0SP0D$$:0 8D0SP08|dE(0`$0,0UA0}G60yB0uꘃLE`B괃H DẼ?E;00 0=P44040080H4`P(80| 0 40 $0S|J|0< 080 $ 40rPڐY P W <`:G:S P ! B ` 4`@pD4 $|0 :`V =댅=A`P80SB8̳W8 ,<P# D / 6p6P `~(!1P`n+,; P4 (<`f800( 0 0P0 /40640hІ~D/6倳`800( 0 00`-(0P`+,; P(  oBP `0Z` (bB0`V=@`̇4>D404``5D40(.D /<^6O8@$D\+A`Pr80S8|  ,h;P  D갈D8004 0(1`0@-QM@ 0 00BA0C QS 0A0C0B PSR ;P0 C V=Ѝ00 C R 00C QS F1P x0 6 <4 9=Q DQ@000 4CЍ 0 Cꔅ O-@PMM#6#@`phhS0P Ss0S0 S SڣP`z#S@0PVD 0mP2 \TY ;@P 0 00/P W $BPU 2 NC x5`  9C`,@<ڍЍ$B 1C`@`pPUP4 P$ T$ r@PC P:00 S&500 @!0P$+9P@P PA B: B 00P 0 B0 BPx0B @7PlT0tBE@0dB{,0LBvl Dd F l D  v | @ P 0O-$M`0pP@PC Tt@T@ Tʄ4T)PpD%MD@DTP7 #P1``@ 4 1ЍC WB`41@ss@7X O?P X ; X 00 X3GH XJ ,P@ BP  wKP 2W ! `0" pP @8x0PX3@@30 6Pڈ"[K   8PXp0 p P @D2W 0   0P~ BB A4(0 = P 0=P0m  RjX(?00 00@ @ppFP AP0IU@p20uS?0$:(?s0j@A0P@2007k>`P 7ㅰ `0c PD@<@lnA00 Lv:w꤆   T D  <  ?v   Q/3 W>O-M3` 0\2p! L#4A APTp@Tm 1S 0S[ X/ `  ?PC +>P `[Vi1SCLL ;0 0o@PM 0S0S[ >P0 S80 ˁSЍ 0S0 010$ 1;0@mU 0 0p@0@`0 @ί @t00 `Q ,2(0@@\ @  p I    ܇ C-MMp9P@G` 00 - d7VR0.S&  3Oo0B1`; 8 0p`W *52 P *xp 0pڍЍڍЍH ܇ 0O-M H0P @;0P808$084S3PP;-`?@Pm  3Ph UP1 H9@PH. g?80@000* {00P,0P( (8$0@` 0'<P?P0: SD .R>P w`c7@P< Yp`d=,0 S((P DgZ pP0Q0 !0R2`V 0 UJ0S@,p04 0S@60Shv/p1|&\1Y `Q R* 0 !H!`  8&R<64S $6 0? 80R   R/R 5$054S; 5 |?50S0qPUᤡ @qPUᤡ @1\%1`0d%0 00$00 0<54Sh3PM{8Pppp 1$1`0$0 00$00 0;44SS3P<0S{ 4Pp/0 x$?(00(0k,p04P$N10S< `0 V0/ <$=1(Ѝj< R #D < D0@t/0@ <>(00(0380 t 0>`38 0t >P30<0k0D@0;<O/@0D <0>(00(0z#0HD-27000(0P0pPS 0 -`4V /P<Z7pWd 4pP0  7Pe W 00CS8&+0Ÿ0 0 00P!0$ 80*1 o>0(0(Ѝ1 e>l1@0 \>mH1`@0 lR>Pb(@iT@N L0P3`0@ >@ꄴ \    D X * ܇ h T p d t    H Lc T |   , p@-!M4P`A%0P Ss0S0 =C0CSP' 0P0@a4d! -X!@?P 0R! 0g 0R0  1$ 0 0Ѝp0 =PP0 <<P : =@P: 000 .0P0X P/06Ѝp@$ 0060T ԇ \ * D 5 = ////w: / 6O- M0, p`R4@0i SSR 0P=0  f+80 S &.82 尰岰 9=0S S .S* t800S S0@/Y0* PppW+ Ѝ08 $= Ѝ0S U80 S` 7붰0 S0< < < <S\Q/) 000S (80 S` 7100800S S70@/Y0,Z00S <0S0 <0  * 0 S0 %7P 0S S .S0 S 4<0<}l     , O-0@WM/M 00H P@@@@AD.t  /000l0?o00@@@x@@@@@@@P@D@p@@4@T@X@L@h@|@@@d@\@`@8@ @,@(@$@<@@@@|0P 3Ss04S00 .Sf=C0CSZPܯ ``0P(P0 h<`pP0`L`H```4`*|?@b5`5872`+-[8$f1(d1,b1 @/+<$-&.409, ,4--@H0P h-H.L0P P-, . WލЍ00 BSrP`<0`L`H`` p P4` pP0`L`H```4`m BP^f'0Pt0X@_d ;sYMV B0P<0F T$;cI 5@:C P4U00P0/0S5K50P0%F- ^;pl0 _;> l<;|00  0@S 40 00P  000 =:0P.  0:P 00C0Q *Qb  s   0QY j-PP\ d;  G-PPP@  ;`p0PLPHPPP4P00000*0,0S ,e.P(0SM ([.P$0S> $Q.P4Lh~T{x\u~ SPowHkirpfocld`i0D0[00D0W00T0x0QZXNW ?PHiPXPCd:0?00P0;0080050D0200/꒥PD D0SM \0SLh0 ⿶Pi PHɴ8P0 80Sd P0S|8崨8P# 0H S p8ӴP \8PQP |0Su SP `0S` `PH0 `P7^.0` +`Pe G0S P0 00P7G.0X&+P 0S  0H07h00S0L0 h0&07-PP 8`P 0 S1 h0%6P 6P% p50P4 @0 0500去PP h06岤40S d\9T0SX0S T`45 Ԯ0P00 [T \0S9 9d0SI YC 0Tp0d4Y% 0 @ R@P4@( 4 0 0P 1,PP D0P 0Tp> U; D0S. 0S&  04E 0 7-` R 0,P 4P 0#{,P | (0zP㘤 X 0+R00S  P0S0f3P 0P00S XP= , 廱PP2 $3$890 0# x 00  TPQw 26Paw LPP 0S0S D0S < 1C)P x0S Z/ Tb0S% D0Sw .@Tv $24P4P 0.p1W(P㸢d p+p]21D0 00S 0S &0S p@d8 * 3P 808Pm *࡟ 8'0 00#.P%-5PU8 PH70P$0m70P(0h Љ d D `&/1 \     | `  L   & 4 | \pXPLT H ܁ $ P  L 2@ ' \ 8 H} H  P l ( `  * v  \   L  l  X  @|   B70P,08l0s `80S |08p0S H 80S% \0S[̱B/P ؠ770H R!"`P |'*PP 1.,1L7\0Sol7}1D 2P$" 10P`01H"1|:0DpPx"`0 77[ h@ R兢0"P;040S 000C S 7P2404#6`Vh XU 2PX <QL >(pA.I)W7 0P,x ( )C/ .300o.P0 S Sʐ[(P 0$Sz$0SP  $/ቭPP$'Pe&0SP0 嗿PP 3T0S P0Su T唼PP] h0$l4F0P] nR oR0St00t0p0@St00t0000t @@P,PQ$0P4ã1ó5ãm0C?oW20S 0pP0S P 6P5 ` PpPጥ0`L`H```4`'P xW'PD'PT'P0]<@T  Po <`6p1:@6PP pE |%0Pp4 (P  5PP ,40S+ W c>4('5`d0S Yu6PTpXTp4xj6P0S%Tp, \7养PP d0S YPP6D0STp4X0SX00P[`00 `0496D46`p$0PPP4Ph0(48TP0TS 6T0SR6p000040P`Ἠ60PLPHP p P4 ,50`0h0H) 9Ld9d)h049HP940J000C S? 5PGP0SP` 5`T 5ƝP -pB40p$ 4$P%$4 @5`0P0 #0 3`P# n2PV&+U ᜪ5`pP0``4`o Ԫ~5`pP04a+4 p P$W8h5Y 00 Tp0d+d+0P40)'a.U4T QPK#0P0> h0+;n0PP C2_oRh0K,aPd= 40Pt02 h00L4,SPh& q40P0 4#P 00S% &/P 0PP~P5pP긬h 4h00ܬd 4d0t0UG -+p 0Pt@%U't-0S P , @r R:" P0+S000000 0(P P%P D0S pDP g-p  0P P$Uk0P 0Y@P0 *pP4X0*0P040400Y R  R Ȯ0t40d440vpp!0P0$ 0S X/P X$P l0s p0S X`Q4l0p JP 0.TPPPP0pd00%%P rj\0S *4[C  0~  01ON(` R 0%PE L?P 08/%P 0S 0 .P( |0p̫P P0d00PĮ3갮3   ~ 0n1+P 坫PPX3<` D3ףP 3z0l0g.儦PRo)00XSp 00 P0d4꠭3)=0S t#Pv 000tP@@#TE,@p.PP@, 0P  0P U E}0P Ew0P U 0S ,0Cs0S 03 0S@0+S@10P0 @. 0dSPiCO ,.,< 0P0;de<PPp.dQ .; 0 0t; dHPV.dQ -P; 0 0; dA?DP0P1;.dQ -: 0  0dB? )P01:N 0:@01 01kP P9#P# D0S 0S #P:0S D0Cd0s -9 0 09h٠Pԩ-0dS o-9 0 0L9 h徠-0dS Vn-,9 0 08 hA?⻠P01-0dS <T-8 0 08 hB?⡠P018^ 08P01 0 1PS P? d00d0@"dP0*P@00Pt0 v- 0dSv0((2!ꨧ#2 2cꈧ2t222 2 222hPp PD0S XTp4n䦟 0 t .P(10 )PF0T0S XX ` P 1`Tp0dh0&6X0pS T`TpPd"PإP"PY )0<1S00pPጥ0040`005h1PPpPy@1pᄰr-@*ph` w1ꝟ 1P x0Sf ' _x0S^ D[Ux4Z1p4 U1a*qL\*-0Pp00040-M*-F*`>"Ph5p/ |pꤣT"1"ꈣ<1"l,010P00040pP(C-PPpᄰ0pP p PԢȢ0k^000D 0# 0S 0S (0SP0MY 0"PdpPP4Pp0PPP4Ph0"10P0|r0X0PSX000 @00P00040w,pP .g p Pn |0똰fv00PpP0[l0& Ġ0{*P &x 㹠 tdV0,Y@ &00XS P040l.0pp/p04l    8 p H  ` h p | @     (    4  P p   ,   4 ` v 8  d   0    @  X $  <     |      O-0P`@(MP T0@PDPHPLP(,ph$P PPPPPP P@P7 T,t0S00 LL eP`88 4/@+ !@.D'!H'!Ѝ7T7TP@PP @8P 0Z00SH0D P 0Z00S 0L 0``Z0 Z (7 0 D0p\00X *P|*P   Pٴ0P 0S 0S b&P$0S0S 0S`D6hF/P0S &S S# SH0SX[7 0   z#`Q,@P @P ) .@0S f H@T Z* "P0 S( X!x(T n((X0X0PP9 !P@64$@.@- @DT@  T P=000$0000 0 spP VP`@P3.`@`L03 0 D0pK00 h3.@3QC Q  `P l**0S SV (2U`@0X X0 h.X ]! b.X' 2=0 Pnh21 0ᤢ "[2002A.`@}P0 S= 0`\"UD20   w"`N+P1 #.@aa . 0 0PPP U: @1U/ PEU P00S@ 0"x !  @-Qp`Q@ MB10t!-(P@@O0/S'P1%@P<1E $0S0$ R $ Z+  Ѝ  <& 0S Ѝ0 @+S 09+5+W0 S  t,+ d'+S P!+ <+x * <8 ( p" " $" " ! " " ! D" C-Q@ pP M D@P0 @)P+ W- P* 0( 000}) Ѝ Q%0P`# DPP. @P  }P "P [)0( @& Ѝp0 l*gP  4004* x ( ԓ " * D" " A-M`p'@P0 P*0@"0C?oq20SP @T #000   R 0 00 @ЍЍ000  x O-P Mp%b`P2 0S- 0# 0 @J !PY 0SYH 0P` Ѝ8 8b Ѝ$ [# m" yO-@4MPp/WaP<*p`  0) ),00 p#W` & )V & )$0(`s  t$ ), (~  Pz  ,0Sc 0), (l  h 'P )ZU h#c#P8 (0S5 h)( ) )嘘(p$ 0 'PJH{)0SGP, r)0PESk)(d)0  4ЍOxQW)'w'm"P4 P PH)r`  0?)`0Ph \6),0p0P`p P !P !)q`E 0M%")`6 0>X"`P P ?fP `K'0 L( <&8($&((_%z(!0S  ((P (<,00  \P P 0S{;Y pP !'`pV 0(PY (,p ` 0$(_ y(Y m>p p(|\l(" 0Ph ,0$, '0 , P ZX & 0K([P`D(<(P =(0Syu&4x0(pPr \((0 qo,0⨂00(\ ((\(T#Pf # P U b '[X5 L`'[G  `n& ' 0'8!'`p 0'$P 'kpK`E 0 ' '?' !(' $` `"&T ' 0 6p4' W $p  E `& ' 0 [ 0# % $% x T% h% x% % % * P& l& & & & 4 ;" # # % q % 0& <# T# \# # H # # # $ 4% & * d# & h$ # % <$ $ $ $ $ , % p@-@P,`PM x0P 0dP ЍpH,'44&'Ѝp 0, 'x & # & p@-@`P#p 0U0P00p0'p蔅 ' @-P M@`PnP.  0>`PB Ep D&W 0 yP U @PPU Ѝ0 Fp0S  @P x L\ PD80 N8' `' ' x' ' L' ' ' 0S* G-@p `RM R+  R0  BR   ЍR\B\XCL\ 00 /000 00 Ѝ  P{ E% 0R{Q } %0P : 0%P 0P Pt0PP LP@5@0&kP0&  0I0 A XQ0  0000T00 00 %GP% |0t 0p0 00% pk\`000 008KP4TP >P ( 80PP 3 %"PL3% G0#00 00%W$/ 5P0CL3h% B000 0 0C 0Bz_ #0JSs00 0P_2hP2UPPO  P1x20 d%!P0K  M@2XX%V# @ 2K%: P  P P1 3% " P00@|1 &%0 S0 00 00pP 1X0%0H %0<%00%0$$0$0 $}P0 $0$0_0P 0$0$0$0$0$0( ( (( 8( ( < ( @( ( L( H ( ( ( <+ ( ( ( ) D) l) ) ) ) * + L* |* * * O-M`@ᐁ唁0+ "8 1#~?_嘁圁堁夁威嬁封弁āȁЁ  +/#(pT PWpp10SpWL sD@ o84 k0/᛼0 dpp`0| L001110t0x011P00|1100 10D0000x1<0$0111t1p100100p0h000l1h1d100 `1000000l0\1X1$11 10(000(1T1P1L1H1D1,100,0@100<1014181H00X05P W5 WP :P5P" 70@S;0@S>@ CRVX0S X@^P XPt0 #VZ`,0hS00 0@S0 #p@I #0`$0dLPhl\`4@(HX,DV l0Si $" , ',K(n!DZ_+++xL+`d+P+@x+0l+ .`P+H+\TxXH0M!@ ;* 4:* *: !hgd0P0`$ߍ  P7L0S; 0 x#0 l#|0 X#p0`$0\p`p(p,pDph< #(#Z  RgPL)P5 BP)0C/S00 㬻Ӽ/@L T )@"LP 0S000D0Sʈ0S p0S00S3$0 ?C?oR20S:L R g.qa!1S (D1S ((Z 0S a堡ZV 0p 0#R00S X(!0Pp0 p<(!4(@`!PT\00 .g!1@S 'P1 S '4T dP 0j/i!P 0| 0C?oR20S0$0Q `lP 0Lk/⚞P 0@f/ⓞP !0 R S R0S# h00701ۣ0PD0 ,0S%0S 60.1Po (0S  t6`P4 &!0P(0% P! ewP 0S] 0p~/NP `8 P 0 N0S X0P* 1S  .`P $0S<0S~1Sv0Six1S0S0S0SUd1S  0S  Pr H10D10(,1 0 (1T!PPp 0S `Pb P^  K0S  % P` 帬d0S: 0S3 <o0S& `PY 0   0SI 1S  PQ 0S #-0S !q`P;  "P0d#y3n0Yy D3 00@ 00P3 -!)&0|1#00 00000000ֹ «hйF0PP08`ȹl !0P $0p`( \ ` , D T00T00000T00000000$1ꜹ<ꙹTꖹD01ꐹ0ꍹPꊹ,0 1ꄹ4ꁹ~  x  r   P  P   P00d  1x " + + + + ؓ $ R + t         (- D + H, , $ xz / p :< 9`9x2 , ؓ ~ 7" , d~ , ( * D, h- , - - l. - d/ @0CST咶PH 000]>@ 0CSgP<` p\`0 0PH0p P0000h00 z00ꐚ0 qꨚ0 k0 (ep\0`0H|\0p0 $q0 `",0D0DeX`l[ꀛV0S 0S K0SЛB0`$000 <8 PT0,d+@t6S\ t ꌜꠜ괜,0SD0 h0 0<,01岞0PD0 = 0,1|`P ,`(!D0$0G0P(`$0,`@dx `0$050ᘝ(`$0/ꨝ0 0 R`1S~ 1S  P ڊPo ӊP D.~ $1 0<1!0 10041兊P ( |X1 0D ,1P 0S 50. 16 >K1S 0 0t!0~JP 0S P1 04/, 3 D P :`P 1S 1S 0S 0S @P 0 cqY 5P h1S 0 ! 0S0p ?o2R0S p0S 7p0o P3 0S; P8 H0S- Hm $8$0 S2 H@@00!3/0P Q0800405 6?-8 Z 诟 00 H0Sx0 t0 t0 R00S0S X 0t 0! $0 800| 00 00 011 0g P !$0S0x0S @P  cP y/P p1  l1qS z?  ! 0 # pW 0y Pw*0_0x P` 0SU0S  0S SddgP0 S0P0 |1S 8,,V 90 0S 0 Ax 8p?+= @0  ߔpW!ٔ000S011 0000d 0001\ 0`0P 4+0A S00 e000 y8 @!y?P PPP88@@8(0S2 0y (0P~*0 0x( P#p4 P (P 0Sd(4_8# 90] '*0u i{0 !{{ #0{ Q ZA0  uWvZX PN$P /P00O`P<0S P <0S P@pP<pP0SVT0S t`V"00P0ST0 `PP0ST0 S V RSppWb (PEN0S``#XqT p=)0`P  P  0  ,1$ 0  0 `8h 900` p_  _ Ta ha Q `_ 5 0< _ % 8( a _ _ p` ʡ ` ` Ha 4a ` (0 <` H; 5 T` ` ` _ $` + ` a ` (  =;P00[  21  ! ! 0 0 0xP000  GplPWP21 p  1 00 0pjW @0S  0 YXQQU qQ rQ RQ 0KS cQ0 S S ` h r pP <2@ P 2 bT %깆00 0  WgIYf0` 0  YW P `0 0  yᛆ0  ,Pl 0  ,aD  { `P0@PSppP Vx Pt d `Pg88Yf 0S3 =JP0H  R`Q 0I  q R`F 0S*'4W 0 S S4KAo I0P 00J P05\1 0 S S`5y`0 r  J_0 S SP 5V W, W`P1 i0 P' 0  A0P0 v0 0 0   T6 6PK `7 qpw@  `X7X  _t  07P PQ ?SQk`dO-M z`R^@[XXT00P0SPb{0S0)uC PW7PS 0SZ   LP   P ,0S }(P |   0 mLn0S00S S F40 S 0l80S' ) 0 P PP8z8 $*$5,USЍ P 0 P)}PZ= X0S Sm P  |P0S   S :S Q= Q7 Qk.S \S/S0S  eP 0  P P 7PB 0S6t8 18( 9 06 =P P[ 8} 1P P ~S| PQ ^g 庼q  .t78Q  qP, tk Px ` @ wP}ڀ 0[  Ȃ 0Pڀ0  &,)&#\0S!`0 0S &Sr  0S <Se >SP 0S 8\0 S  A>Pp ] Wp0  0W00:W) pP> p 0S2 h0S* :S h(^ 124 ş82 SO\S/S4 .Sl M ᆭ T {\4PXo p 0(c "i [ uS K pP1 L -S I l8 R XEx000Z 0\S/S9 <% w0S2* T2ӂPCd2"QQ:0Pp 0Sa X0SB ) I0P% X JPP iP 00x   z <  p 0P0 | 0P 0 0CXP HP h0  P 0 b|a @  _ `_ a a Hc Pc c 0< ; a 4} Dd a a b @b `b b hb b b b UUUUb b 0# # % # ^ ,c c c a dS H 4d c c a d $d ,d d c O-LwP'@$PTp00 #g^)0u P\c0P 0S`X [ P  P  0 m?0S00S S 40 S 0= PW PY0e PD2D ሲ "hpPPs {P 6P[ 8!9 0T 0q S S-pW  00 T0  PLP >pXa jPԹh0SW P p x0M4  e_l岹D0hW0S$01Pd @`_  : ; dd xd d 4} a ha O-PpP6 P. 1@T ԀԐ`l 00   @TQ Ph@l0S \  lQ0S d d r t d C-|M@ Pp, P @P 81pP P 1p0000@Ѝt 0PP0' '0P' 0P`  ^P A P #WP P`Dt @, 0 + ԓ `_ D" " A-Bp0M S`P LPC UV 0S)1{P0t PPX R N l0S4 ЍP0L Q ,Ѝ0 C0JP 0 6P-0S & !tP0S0  /0  *,0t D 8괊 + `_ p" e @e d e e d D" e G-$aM@TP0p 404 0 @P@0S Ѝ  W T x@@W Pp0  0j@ 0@W a괊 f e  G-xxP@`pfP xW 1 rP` V贊 @-@0, ,J @ LC-鬐 M|@T" `P0`S @0Sp 7P0V8 80|0, $} y Ѝ贊 )`_ *+@-M|@T pP@T 0S  `P` 0\ 0  @%mPm0  sЍ0Ѝ贊 (f Df 0@-P Mt t@TP 4KTЍPUV Dn`P Z0  vY Z  rဈPP< MG/00  0S \L0@x 5@ @0T0P ,#04PP 0P40 sd40S $0SxSP BP00 [P 8P<':g)wY 0w[ 0K 0p 4P`8PZ`p(PUL 0@008P<00D00$00(0s H0,IPPr`"PU4 0@008P<00D00 00$0s H0(+PPTZ00L0P L4L0 sL0S $0SPP v`5P0 [L Pb P] P@PP @P ZvoXZP@ 0[ p @HLpL P) zP$ pPP @P \Y<p<WYP 0T[p @0K0GP2 r`Rd2Po <2PeX `3@ PP~4{1l1 P ` eP0P,L)01dw`Pp`G0,h00040M5`p`-0Nt0H\0B@ ; $0T4`ꨥ dg h h h g M`_ NOg g @h g ,g h th O-gM0 `p_b @/DaHaLaPaTaXa\a`adahalapaqxa|aaatq\`l``,``X```0```<`BpPY@@p14S@Tq $`<`(`,`8`0`0pOX<|($w8 HL.T.P.|l.lp4|@T A-DX.4@H. T@|@$...l7 Ix--D˨, h0哋4@4@gߍ  |-喘0Tp`ph-,x `-``X0| \0 1@@@@@,A@@@@@P@@@$@@@8@h@L@D@@@(A@@d@@@$A4A@H@`@@@@@t@A@@@@p@0A(@AAA A<@AAA@l@@,@0@?0PF  ZR# \CQ [R ` CR.C BQVRp,0S^ ͙,lP ,fP=X V?W8` R  㕘Z/jP|X d`p$`<`(`8`P jP D0d ?C?oR20SX0S T0S( P0S <;;QfP0P,0O00}IzFw00t00q 4: m $: i00f2lc00`,])Z&W00T QN00K0,00G0h0D0h0A00>0 0;0000P060000,0P0/ , &$#  000A  P 0P00S+ P0ڗP0P0ӗЗW/⥒P9ɗ Ɨ×H.╒P)깗$궗 Y/⋒Pꯗ<꬗(꩗ꦗV/{Pꟗ8ꜗ$ꙗ|H0S0H0' l0' pl10p10H0H0S 0H0L'l0<'pl10p1 0H0H0'S0pH00&plp10l1^0.[P7p!H0&S0pH00&lp10l1A0.PnL7p!Ps`嶘p. 0\( Y V" S50S0h0K6 P0h0CnP? ;\50S0h03`6 p80h0+0t0(Y.lcY.Pl^ $%pX0p10H0000ږPP45@Җ  A0000`00`0000@0000($0000100ꮖ꫖ꨖt0S 81<$ ;8 52,/ ,0P\0(42l.d  0P02@"X\0s9\00800d0 00 000000@0 0괊 6`_ + + t    AD   $ & ܩ hp $p ޡ $ D Pj H, , d~ + YZdeTi uv(i ~ i  , i i , p k k Ll t4l 0pl , l H DL | t ؉ m   @+ - pj j j / j k 0k Lk tk ( $j i 0 j @0  D 3 L m  l k m 001041@0P0T SR Q00S 0Q0TPQHAo880S``V < >U/xP 8 |R00 xR8000Q0̤P t0S<`8` d0S _isPx 0S01 a^sP (0S  |2h}pP J0P(0 P $pW 0002P0 P1d}P/ h20 P1`|0P$0  0S 0$# S/P 0S t0Sx00x0|00|0cpc@ Po 0 N`0S , 儧Pe 0S .P D0S#L0SxP Pds&P x ,DQ 0S0S0S ,<0S0S0S0S0S0S0S0S P0 00l0000niP p0S 4P (p \410101010 piP V lcpfc@ 9Pl Y`0SxP PPul_P x FDQ l坣0S0lS0S <0S(0 00l000l0iP p0S 4lePc (l ,l 幦P x1S ^/1S -!R@P ,7047n}pW D0   P qP l0S 0SN 0 070x7 }0P@0B 0  @plOP p08 0<H19P? 0S P4 lP 0 00&P, $0S 0 0$L1P  0SRt0S 0S0S D0S P P4 pP( 0 pp0S PhL)A ]P XlP h)) l]P 05)l1ab? 6l5)X 6b?0pS (!0HP P0S,ĦpP\0S0S0SxT; 0S.0SJX :RJ@810!60S/ 0@0 1 0$1l 0T0 0 H0 p!/(P0zPH00C?o2810 h,; @;T;h; 0080;\0T1q{0P80 ; 0|T1X;z0P<0 0S <0t0R/}P [ `Q 00 0T<0\T1K{P? p< 0xT1XzP `< `p$(|<<}<Zp$sp$(<lL wF|0p$0=<Zp$( `p$(Υe0S 0S t0S ?M 900S 40S ltP4=$t`p$`(`WWQtDSs6XS S].C BRdP:+cP5S }S4徑P+ p00p0 B#R>p"p$ P` (P<lK0,! *00, 0|L P60{D wP.)P lP{ Pws?$ @3OlPS ?# @3lDJtl0S@ #lpW8 l2hCh^=LC LV5,C 0N-t0Sp0S lP  80  N0 vpD|0S 0 0202Szp#XBt*,BH0,!lnAq0} PK0X m04 P:`0X _ 0+,0#0~ P(0X (G@@@9_ll`l*Pl0S Fl@~" *0d`0, _[W0 vlWm + m lm 2 1 ̥l pl , l l @m m 0 0 0 (2 `0 k  d1 @-MPp`R@P/ 0 dP'0 xP V YP 5kP 0 P  0ЍPPfPЍP@P0H0@P V. ꔅ 8( d~ a O-MM@P~<'Q`pPԧG`8`4`0`,`(``$` ``30P Ss0S00 =C0CSaP 0PP U <A@P  0{ Pf`P 6@`P2ݍЍofffz P |6lRO0T&hd&0 00080040000U$R OL,IQfPD(A~`@P8u5Prpn 0|3P 0SwU P 0S P , (劘Py 800$04 000 00*dP `z 0 00po@`@,Prp- d4`#`0P/  PP Y 0 $@ P@gPʳ@*@HPPk3Pt  P*30#`@o{z{0k[+S[L`H0WP@0 P k0  8`  KPP Y 0 @`"k PjPe*PP(0` 0\03opvPPrp' 1@30P2 P) Y 0 !@" P @P`*@P(1Pt  P*30.x@`@s@`{n*{z{0k[[+S`W@ yΧ 0 H `[H0 `Ud0hA  ~ P D ~ ~ d~ 8 Ă  Pl     O-3M#@007pS@@#`P  P 㦍 {PPp3 l`@-aЍ葍`PˎP @ r xPP^ T0`  @T eXp  PU PP\ ?o2[  RP w 0xPPD [ 0P [ Rn (Rq R9 R" `@@@@630 Pz`嫎P@P`@ xxh@T1hR`Px8!PK`r !<E`l0K0S0 W3 00W  RY  R! R RM     L@t:. @+ D ( xP l H ā  O-P MD#P.p,c,@P> T T=D0CS0 t6 T`@Ђ/  Ѝ]P`@|zPW u.P DD k #P  `@pP0SA [: [U`M [ F`P Pq{[UA z[0  0/X% DQP@!@ b ( [ P T䀟܀NU) [ O[`ꨀ@ ?@kP5[ 0 PU0@P<ꐺ I D  | ̃ P  @-@M+P TPiЍO-@?M00P`|@@@@@@@Z0PPЍx/ @`pl?l_$@04@0@p@L@P@,@ @T@X@\@8@<@@`@D@H@@l@h@d@@(@0P: 'Ss0(S00 .S}S}.C B#R  .BS S]>C 0CSB^P \P 40040000\P I& P~$ |P` 0 P,PP$P0 KI n$ " 2G? }$|/P(Ѝ8 |@|=k@0x@`vlt`r`p `n`l`jW5W5pe`claWWp\t b`WW$W$pRWvWvpMWSWSpHW"W"pC0p0@0P0=0L0:꽊l7꺊h4귊d1괊.걊 ↅP(f0S 0S [j \PT0Sm TPL00哊 ꯋ, ꍊ ꊊ<0S [D  ;P3 R0000SA .P&00mjTgXd\000^H[`X& -P QDT*SK7l0P(0Putl\PP 0S pP ,P @P 0 0S0R0SR [ P0S 0QP08 mPr SWP00Z 0000`)  uP 0t0,0SW 0 0rD Vu0P$0 t0S! &YeP 0h(S (S S$_0S HX |7LAP| 8`w` )u0P0 $W? W U 80SW9807 pP `p) @0 cq@PA 70 0pr`P4 80 000P `P P@pSW P \0S  @0X0S  @0T R @00h&S &S2 S80$ y`V P,` 0P` 0 P,PP$P0P P0P0P0P0P0 0fW "W t0WS@ 08 lPy @080 0t0 S0000Z 08`00< 0| 08 lPY 0@`0Z_ 0,t0<0P0"W0Sw 08%  p0P 0 0S 004 00@q0P` Pt0$0 00 ,t,uZ 0 0t 0,00$  sP`PtP 0 ``$`004T[~sI0PeP`  0,00$0Is<6So 8`s00*"WM RI 0 0H35W"W "$W200$ 235W ʌ""W200$ 2t25WZ 2|""W200$ 828u25W "$W8200$ <2frD s0P$0, ,W$25W 1"W !$W100$ 1H1$W' ʠ!WX100$ 1H90S0 00S@  0  0 ,t0Xq$ !` P4q0800 Pf8`W00 0$,PT`p P00 P  D  d FdS 4Z Lq \ \ \ xU ( 4V T  , XV p[ ` @ h V ȅ ] 4 [ [ ,T 0Y 8 0,0 0t00x   rPLpp0h 0l0L0dP0``P 40S"P 08P 0|0Pp P. ( 0PS L0P p`@?gpW@`P 0,q`P 0`eQ\ "Wv 5W`, 000 0'q0R$ |0:8"SW<20H"5W\20 ,t W0P$0L 0hr2 ` 0Pr ,",>20$ 0 3rd`r,P 0vW80| $ q`r00<00TsP ` 0$800 0 "`PsP 0#SW30k4i 0Ps,404~4$SW840=P4;T4*X$SW\40% `@P\t@% 4 R80:80`8U0Y0$0 PP0 8P0 @`0Pt800 680` P$u `8`P 0n0P f g P0_80$ `t0SP00W0S- l0P,0% 0PC pP M0Ta  @p]0pS@ 0S  Ѝt8 @-P0@ M0Ta  @pP90pS@ 0S  Ѝt@ Ѝ8 A-pPM@T @k 0`r1L `0@S 0S Ѝt8 A-hP@T @0`Z {0qa o0@S 0S t8 C-P0 @1`)MT,d  @، p0  pP@ 0S 0S Ѝt@Ѝ8 C-P0 @1`)MTew  @، 0 pqP@ 0S 0S Ѝt@Ѝ8 0C-P0,M 1ʃ :PhPpP0@T @  0P 0@S 0S ,Ѝt @(`(l0 0,Ѝ8  O-AMPU% P00 wo 00qq0 P  0  PP0S 0S ЍuHPHM,P0 0ЍPA 8 0 L O- A0M 0 0 0PUPvo 0q#0 sP  0  JPP 0R00 0S ЍuHPHP0 0ЍP8 ` x O-@ MPU Pp` 0n0  p>P  0  QPP0S 0S  ЍuHPHP0 0 ЍP8 O-@ MPU Pp ro0p0  P  0  PP 0S 0S  ЍuHPHuTP0 0 ЍPiH8 ܈ O-AMYQ q0 `hR 1 R 0 1Pa  8B0CRS0 $PW   0PD 0S( 0S 1P7 0 P& 0PS 0S ЍpW0 PhPh JDPH8P@,P8 P0P(8 + + D ( h C-@p04M1:P PX `HPU P  q. 0 P0PS 0S P P4Ѝu4p 0|0P 08  A-x@PU P0dplb 0!7PP 0S 0S uP8 + O-A0$P`UhrM= PU , Pd ( 0 P 0 0PS 0S $0S  &P 07Ѝ )P ЍuQ0 S p( 0 P 0 0PS 0Su8 + O-B4MYm 0 `00` 01hR0pL2 R 0 P  8B0CRS0 Pw   0pPa 1 R 0 p'PX  $ (0   0PE 0S* 0S 81oP> 0 100dP' 0PS 0S 4Ѝ00S00 EPPvU \P`PPXDPP8PH,P@ P8P08 + + 8 $ (  \ A-hP t@PU P``p0  1PP 0S 0S u hP8 + @-MN@IЍ@%@-M>@9Ѝ@@-PMp ` P^~@P @P 0 PP P @  0 P@ Ѝ` A-`p@OPO P 0QSRPl uMP@ Tp@-PMT@PH0D`D\@0  00Ѝp@!8 p@-PX@X`HT MP0DP 0  00Ѝp@8 ܊ p@-`@!#RlM@T00p0@-MP0nP@P$ PʴQR10!0 @ЍPXA`; D1 @@E0P/ 80Pp6 0P` OPP }P k @ TP p0 WЍ+RX 45SS P8 0 ꔅ 8  Ћ H O-@M`P @ @$@ @ծpP( @ 0( pP PC x3 Xp \P  00 AC"2R $ P} $0Sz0$ 2  0S  "!UP030 V Uk  0 qpz P PP p0X"mLD2H p V< 0 AC"2R $ mPl $0Si0 2$ b$Q  0S  "!( 0# 1 00-PP0s p0 00 VH"XsW Ѝp 1 U p@;  0 0 0PMV@5X pKd0SH |@P0s8 0 0pH,0X p.ʹ1/ Ѝ蔅 8 P(Ћ L G-@MPU Pp` 0n 0  pPP 0S 0S Ѝu,P,P0 0Ѝ8 d O-@ MPU P` p ,0 000 0iPP 0S 0S  Ѝu,P,yPW0 0 Ѝ8 | G-@MPU Pp` 0` 0  pPP 0S 0S Ѝu,P,GP%0 0Ѝ8 O-@ MPU P` p ,0 000 0PP 0S 0S  Ѝu,P,P0 0 Ѝ8 C-@MPU P` p04, 0 PP 0S 0S Ѝu,P,P0 0Ѝ8 O-@ MPU P$` pp ,0 404 0pPP 0S 0S  Ѝu,P,P0 0 Ѝ8 Ќ G-@MPU P$p` 0T` 0  pPP 0S 0S Ѝu,P,|PZ0 0Ѝ8 O-@ MPU P$` 8p ,0 000 09PP 0S 0S  Ѝu,P,IP'0 0 Ѝ8 A-@p`1r0M `HP^|  )됊0k1z {[{'@Pa{Ѝ 0 0 Ѝ+ 8  4 p@-M`@L LPetPU @PЍpkPЍp@1p@-M`@KKPPPU PЍpGPЍp@vA-@HM`V! `0plR0 VP  0!`P @0 IP` 0S 0S HЍv`HЍ8 + 0A-PM0 p WzPS PP#@a0S @0 0 0 @PP7 0S 0S @ KbPЍu\@P# `PUP  P  0!P @ PP 0S 0Su@PPP8 + @  T X 4   }D yP 0 t8 0/O--pQ00|MLE4@4@`(0`D(0$ Q  QP6 08   P @PQP P 0  P 4$f  X0P E0P0  @0PLd( H|0!H0p ,@0pS0$0$0@p 0 0  00(\pW) pWp% 0#@PT0  H0PPHPLP@XPh H L H0 P@L0pS 0S 0SQ [@H"P2 J0SH0Wڐzj[{[kk& [ k RS,@0p0M   ` xT 0 T(0A @T  "G"C |Ѝw P@$4 0 0@ 0 nPSP1H0: l `0 ` PT1 q ,u(0A{{&k{+S+ShWPP n@Pt0 PPPP@@@$ <  8 + \ l   Ă    YZĎ  X t t  L ̍ O-PRM M|PUpo@@@ $ 000U' p 'p 0  n:P $Vp $ϟp? .H吐q Rލ Ѝ p00`P J P P00(1+S  0 h T0 S& 0@.S 8.S 0.S2 (.S .S1 .S .S .S! .S = R 4 0 0:S )c=(00S   0(0S+1P ( R0 ( R S0p0(p'@p (0pS(0 S QP ).0(@T0- 0(0S00 ( R S0 00| ``Pq)  Tx,( @(@T@ ( R0(0S Q 001{{7{ W @`@@ 0[/ # );(00S   0(0S,1K_ ( @R0 ( R S00(p (%0S(0S QP )0(PU0* 0(0S00 ( R S0 0) Ut:(  P( PU0P ( R0 ( R S0y02{{7 ){c0(0S) 0(0S0@ ( R0 ( R S002{{7 ){>0(0SD) 0(0S0P ( R0 ( R S00f2{{7 ){0(0S( 0(0S0 ( R 0(Q S0r0@{{7{H ) 8(00S   0(0S,1K_ ( @R0 ( R S00(p (A0S(0S QP )0(PU0@' 0(0S00 ( R S0 0) U6(  P( PU0P ( R0 ( R S0`F0 2{{7 ){0(0SH& 0(0S0 ( R 0(Q S0 B0{{7{{{7{ Wp` )P5(00S   0(0S,1K_ ( @R0 ( R S00(p (0Sw(0St QqPo )0(PU0$ 0(0S00 ( R S0 0) UX4(  P( PU0P ( R0 ( R S0C0) 2{{7 ){0(0S# 0(0S0 ( R a0(Q [ )T3(00S   0(0S,1K_ ( @R0 ( R S00(p (0S(0S QP )0(PU0t" 0(0S00 ( R S0 0)p U2(  P( PU0 ( R 0(Q S0011{{7{ )K1(00S   0(0S,1K_ ( @R0 ( R S00(p (0Sr(0So QlPj )0(PU0  0(0S0*ꠏ Ă ȏ 8 -H +F 0 +F2:+F3:+F4:+F5:+F6:+F7:+F8:+F9:+F10+H h H h ȓ ؔ +  |, ܐ ܏ ? 0 ( R S0 0)U0h ( 0(0S00 ( R S0 0) U0(  P( PU0P ( R0 ( R S0@A0 2{{7 ){0(0Sd! 0(0S0 ( R 0(Q  )x1(00S   0(0S,1K_ ( @R0 ( R S00(;p (0 S(0S 0 S P )C0(P U0" 0(0S00 ( R S0 0)(U0 #( 0(0S00 ( R S0 0) Ul3(  P( PU0P ( R0 ( R S0C08{{7 ){0(0S$ 0(0S0 ( R 0(Q S00{{7{ )4(00S   0(0S,1K_ ( @R0 ( R S00(p (0S(0S QP )0(PU0p% 0(0S00 ( R S0 0)w U5(  P( PU0 ( R 0(Q S00H61{{7{ )Rd6(00S   0(0S,1K_ ( @R0 ( R S00(p (0Sy(0Sv QsnPq )0(0S@' 0(0S0P ( R0 ( R S00wD01{{7 ){0(0S' 0(0S0@ ( R0 ( R S0001{{7 ){0(0St( 0(0S 0(0S0 (Q R  q{{7{(pZ Rp (1  0s0S89\W @X9x0:S )9(00S   0(0S-1P ( R0 ( R S0p0(pE@pp (0S(0S QP )L0(0S* 0(0S0@ ( R0 ( R S00zs01{{7 ){%0(0S + 0(0S0P ( R0 ( R S00M01{{7 ){0(0S+ 0(0S 0(0S0 (Q R  -0:Sn0s$<(WF4,$J@@<NT<@0d C t,tt6|0O- PM 0V  PI  PO@PA0BTp` 0PA   ` } p x s @nWV TY00P0S' P`vt rpn E Ѝ\AEoЍP@┐Eeoi`P xP  rPP jPP  dP  t^P \PP P0 00 P, H} / l- h ( ?   O--P`M Nа԰G?o ⰰذ఍ $(,04帼Ἴ, p.q0` p|00eT^T~Tn<T0t`H@hlxt@PD T >T@ T T@@ =D0CS=D0CS00 eCP?p=HP *ZP>< |@0(>0S p@P@ڠ@0@< @0h0Kt@P \ `}A BLpK10E0S0C0S0SQ nR  0, 0;T0[ ; 0, 0;H0Q;[t,0X 0d ;<Q @.P{P,P[0nS[0+0;QZ  1SO 0D@@P 0H $;R( ,0됚 [zk{{'1Y\{30T0S0-*1X0H ;R,  0}0  L< H L@yD0,, _@0= ?1SO 0D@@P 0H p<Rt 00H됚 [zk{{'1Yh{30T0S0-*1X0H <R0  0*0 ? K< HH:K@yD0x0 @0 @1SO 0D@@P 0H =R 40됚 [zk{{'1Yt{30T0S0-*1X0H ,>R04  00  TkK< HcK@FyD04 @0 =1SO 0D@@P 0H ?R  (0됚 [zk{{'1YP{30T0S0-*1X0H x?R|(  00 噿 K< HK@yD0( f@0D WB1S C0BD0HPU# {kk>c l{k D0p S@ 0S 0SH0S{}kk  {k,P000qSAP= H0S3 {0 {{ {ԼZ p@0S 0SPH0S[{Ik K[[{K[<帼Z0S00 H@Tk {{{,{0奼0p@耟00S 0So HPUh {kk {k卼pW @00L0;Sd t  "``@D p ? ` H P x Ħ ئ  D X D ؔ X@=*D Q R0Sb HPU[ !  tEL0;?H0@S[{k[K[{K[".||*PH0S{k{{T+S00L0Ԁ,:SN  + BD pZ@B*D Q R0S? HPU8 !  L0,:PH0Sk[{U+{;K{ +S[k;KTڻL0;wX01\0i/111111111YԀZ PH0Sk[{'+{;K{ +S[k;K嬻L0,:lD0奻D00xpx@P0}Xp0 LD@$&0n ?  l   4 4 @ H $ Z,6  t GL ` 4 E?l \ < L + }PQ* 01Xp0H L0RX< 00 `wD< HpoD@Rw<0 H!\ Pz0k1z[{{'Q{0T 0S0_*< hr Q,XPpMDPT@9LpT6!(H(&08 T&@iύ0("(nύ00Bs00v2@p2t  P <0@P-Pl iP P 0]RP`00DP@ 0H 2R 80pA됪 [zk{{'1Z{30T0S0-*1X0H D3RP8  0#0p 8 pC< H3C@zD08 @0 pplO`0pMS@#00<@G⊡1 hPhN@hP0@⡍TP0XM$6@006|@QE$61 0X10H4\ 0@0 ѷ 9PC< THHC +  $a0T 0S0*< h A YP@0  R1SS1S 0 DP@p0HT&\X @k됚0k1z[{{'01{0T 0S0* X10H0 S 0N0@ c @B< H^B@y0 <0 @P0}Xp0 LD@$&0E{PQa 01Xp0H 7R@ 0 0 !B< HpB@{w@01 H`(\d Pz0k1z[{{'Q{0T 0S0*< hr QUHXPpT o 囷 F0 {<@G⊡1 xPh@hJP0@⡍TP0Y M$6@P0YP M$6@006Z{@Q $61 0X10H :\ 0o@0 儶 B< H A" " $0T 0S0g*< h Aʴ ZP@0 ;T006 {@QL $61 0X1L0HT;\ 0"@0 7 A< H2 A" " $0T 0S0^*< h A} pZP@0 LK {\ tx = 延 "Q1S8 P h0S0|1 NdXD@x 0S 0-SD 000T08@0C@SP$ @=RDp0hDP0` XP1@@0H |=Rx 00  嬵00W_ <0@p$0S~M[@ jPL} p0 DP L^L#<Ps6L劽AA Q0 'LB$0S > RO 0LP 0S^ _ 0S 0L 0>P 0 L!0  ڳPp LPh  0L P_ L˽ PL  0  PN L08C0CS 0 'L0 LP   8B0CRS0 LP\@@˵ B0 _!L ᇳP pu@<@` Hl@@N>.khlM[@@0zx0 H.\| @됪0k1z[{{'01{0T 0S0:hT1SU1S3V1Sp<@$ZPP0pMS@ 0<!#"X ,hD\@@ 00S0 !| R | RwPPh P婾pPap0[:0 0T30 000!I(0 0B!0 00 `໸| 0 1@00 0<@&$ 0/o"  P` h hκ(P5h5 0hػP? M[@' Ph@0QpH@0Ԁ1 0+@iύ00婴n00-@-< ᇴP<@ ᖾPl iyP P 0MR@0D Њ 0H DPp:Rl 0@z [zk{{'01W{40T0S0.*1Xp0H0DP@S00 0@ 垳@?< Hp?@wD0 k@0I @ <0h)h⌽@iύ00!n00U-@O-, P<@ Pl iP P 0MR@0D 專 0H DPP8RL 0@!z [zk{{'01W{40T0S0.*1Xp0H0DP@S0 0@ @~>< Hp>@pwD0` @0 @ <bC0h@P00S0 R 1P p<@ 况0* *0,0P00 Pp味 p勳0 000 W u0D0pXݿ_@|q1[P |咼|s0HS43DPLX6&  8 6X&00 @iύ0%❼nύ002P00s00<0i/~Pi 0HpH DP4R 0@Hz0[zk{{' !W{4pT pWp.*1DP0H0Xp@S0 (0@ =@=< H8p=@wD0 @0 @P <g 0 =pP 0ts#PlC嘽P|P_#0SPPU,U$\ D h d=  ]0P|`0y`0000,0P40^ P[$ 0 00 4 NPPP0 S0H01%0P|1P010  埰 P<< H<@0H5\1 5f됪{k0"k gc0 .00 0pCPX0M@T|\pԩp0H2$&9P9P0@ e@;D9< @H_p9@㾾0Hp \2 |$6,zk{0<@"{0 `0`0D00D0PJ PG00 D0 0QP 2{ P00 t0 0宬P8X0]PU\0'pdD8 H2P8@㑽H0.P2'7  Z{k ?2kTp50hS0H000@@P@@T@00S <@\PbP ^P\ ヾpP JP0/01 PPWP rP P \"P _/P|1 S `_/Pl\VpP P`P[i/ӴPUdi/ʹPO|1!RKd`_P>01LC\@\M⿺X0@T p \0嗒"'D7< Hr@7@Ѽ0H嗓#/P7 ?Jk{d?T@1{P@0 d೰I@L0@;S t 娰 "D@ @T@* "R\X L0hA<00_?|00( |0劰 IgP0ES0CS P0\ ↱|0@0%Pp(% K0P0 cPU |PڐP%pP% pPx _PtTk 0DS`0dxmPi0PP NP`H,@,PX000A 0P 8P2ڡ%P% PP  ?PT `0S5P000 P p,@Pq 000 P 0 R D0P `0c XhY80 0(@?o dЯL0;'ꨰpL0p,:S  +D@@ 堰pWpt* x"R^L0hq<0(0_?0W?|0`X@0( 00塯 |坯&P YgP0dS_ %P p% mPPL ᅶPHZ PA>P*j$p$  ၶp۷$@$ 7P V,PW P÷Z |0 姩PX+@PJ |0 ♩P: |9$$ P ᙼPW  }Pڍ 00 |0 ݱP  00 |0 ԱPڈ 01*PPPP:P PDP QŪ =P 0 R0Lh\ TX@`6Hp< 0P5@H8P  0RZ{kW\ \, k5< Hp^p5@㽺H7\  0-z{k\ \, @k5< 8H<p5@㛺H 'P 0 zk{WpW%{pi Xh01p,tU`) ,NP =0 R0\ XhE`Py5< ,H@q5@`PSH5\  0ûJ{pkU\ \, k`T5< H@L5@`/H5\ x 0៻J{k\ \, Lk`25< 4H@*5@` H%P 0 }Jk{T@T%{' "P Xhi Xhb Xh[0`0TP0`0ŕ HXhJ4XhD hXh=90 09 =P; 8P1 6@P-#Pp 7 W/i?pPP&PW/[|0@0#렃p@ 0 0۩ PP@ P@ ʩ0  0?0"C0 `_꯬׺嶩0 0(᢬@PȺ姩 @꠰H0S` 0Sn .0BDP0H R #0T 0S0: XX@ h`堺0 0op?,gL0,:QX@ lh`刺X@ Ph`债X@ 4h`xX@ h`pX@ h`h 7 Ћ \ d t 0 $y H 6Д  ` A :D 0 (74 ؔ P 8h T X p9 T  Ġ  Н  t ȣ H 0 X , Ģ ̠ ` @ | v h x d L 4 $<\ h ; ԓ x X x ( ԟ d <  ܞ   t ] 0 t $ \  l B4 ` H $  К h ]PX@ 0h`ܹ:X@ Lh`Թ2X@h`哰 t˹)X@ h`ùp X@h`偰 幹X@ h`屹0sSaZt_PP ҬP ╹P PUPP PX@ th`兹  i?ҨPh 0 0周P r!rP[X@tdC0 0G͸ͩȸZS0ƩS 㾸P0S H0SdHh嶩p10#2P+ʍ@@10 000S0>1@`PH4S0@!@400 ⥥@P 00H4SBލЍ\ 0L״BލЍ@4 0$0(0˴ 0ƴꔅ 0 X 0A-P@w00IS0np` 0 嫴@pG 0@⣴TpW@@0T0N 0 IR 喱P0@D 0@@0~ $0xX蔅 ̳ O-plM/HpLpLhoh_$ pppppO@P Tt0S00 TY?TP }O@P7NP.N(\P WY{zq 0JS`00USPP| L0H 0P' W X_.PP  $p R p ,0@0kY0 ì00IS{00  P X pMD@DTP@zL@PP %N@X46H-HH '.8LT}#(>lЍLfLcLp`L ]}L i>WwLTtLQꀝ$ 媳0X@P\0  p埳 D0U D0 8vR} VR @0S<8 P 0L sP v 8`0 .߲ 0PS 0S 0S 0S 0S +xʲP00S @0SlH+HH勥'.8L凥 <@/|U (0`(0X0,$p0@J{rS0<0 J/o"V00S$ @u 0 00,0Vv 04000 0 ݫ00IS &P 0r[$0S$Z ZA ZS 0$0(0`V(0 0SĚ  0 0, 0RZh ZP Z0 奫h R 0 (0`V(0 0408 $0SZF Z80- Z (0`V(0ؙ40SV`00S 0 嶲@0l0 vR`@0T埲 xY&P l喲`(T&P P卲00S0@ 0 @Ԙ ~V 0 (0`V(0@0S㔘`V0'0` vR0V &PG t'h&PA 00SH$'$僤'.Lx0< T0RX0d0  L 0 X T+Ps &ᚱ&\啱&P ᐱ\0`PS  $ P R T R X R 0S x&0xPd d!00P00T0`0X00\0 0`00d00XP (0`V(0@0S| 040&,0V9 d 000000 嗪p, 0%Ա@pG 0@̱T 䕟Tı0$000000꼕0庱0@P0ꘕ ꄕ嬱p 妱@ R8 Y4ppp0W0M00IS  ᖮP0 4p?80Pv HP p00000 Y3 +0P0 30 S +Pz 0S. 05XQ #Pp* 3FP@h@0Sz40S 괓@804 3l d\0#_`#[d"tWP.dST"TO"HXK 00000804p80 0Ԓ$ |O꼒l@ P꜒P 0{ 0S00X<0  J0V/o0"$  , 4 0   X 0 @0 ,04 0 0 儩<ܑ°ȑP 廰ꬑt嶰@$04`S0` |H媰``0V0$04 40喰40PR1 勰D  oԲ D .  t @ x ` @ @   ̳ ȶ  L  س ܁ d Ե @ <  ( | 8  z X (  , 0 X< 0 t  0x7 @@K 0@.T @DX 啮0P 0G ,0@0Ԑ @500S !x0P 0Q $ PP `!iPp5 |1`P@Iꈑ0<P @=P@00S4@6 1!ӯ@0S\ 040  ǯ00000b0 @徯00000Y@0Sd ``峯l2l"l孯 -@-@ d0`M⣯0P 0 P0!0BQ00Ѝ@Ѝ/ᄴ P O-DM`P@04 ,0|0 0000P7`P ,0S]h0Sbx0S] 0x00Px<0;:Xp8Z800 0'X 0 '0Se X0004 000000<00t0 0p00l00h00,0x00x0PEឝ@PP GP6 x@0 &hP DЍPv圆娖| ꅩ@ޥT , @,00T&0|GT 08&|@0S P]PèPY 5彝˨P |0 %#Y %0HST0 p0S t0S廞ᡦp0St0Sߩt0 000{p0St0Su傦1np0St0Sh ဪap0St0S[AqT0|$|[u @DT@ p0St0S @fLyp0St0Ss @助t0 000嬣gp0St0Sa @-ܫZp0St0ST @˚+Mp0St0SG @@0S=w$#P2P6x0@P 2@DЍᷫP2! P l߫Pw")2Pwd" 2P"<2 D@x00x0x00x0w"2Px0@ᑢ %E]0 ኡ0᪥0 0 Ťᴝ  m v 90 fa ᆥ0 L ɨ0 ᡤ2 ᐝ P 剭h@s|sPd@|yXx0@YP0lpx00x0@00Lhx00x0y T t  T , | O-lM`@X\TP@t%E p ` PXE4D0,8@/,Cx_$@@4@`@d@D@@@\@X@H@<@0@,@@(@@@ @T@P@L@8@FP Xx0S00 >X X]H HXaP@zEPDP zz P lAP 0J?o<2P0S 0h &P  $P ^ 剪.P 弜0P 0 M ԙP 0 S $P ZK Z} 0?o2Z0S 00R0Q0S 0Q0R0S 00 000 R0S0S00t0倜0P 0 $0S ㋡0P 0 0@00S i0P0 ႖@P ᩦ`P  6$@0P Hf@0S  ǞPe 00@ 0㡘PX80S Ρ ᶞPT 08 000000vPD0S G ᡞP? 000D 000bP'0S  e ᠛P LP 0+#-P ὞P} T$0S' N@ (T  崚Oo  ^ eaB PhZ |圩@ᾙl僙h.PƛЍPBP4J C RY 偩 R@=BTYC 7BL4BD1B8.B+B@(B\%BX"BHB<B0040@B,}0$0zBw B(tBqBn0d0k0`0h}HHXdAPz 000\X )X #0S~0 SRyP&  r@-0P0Y @g@Z @ 40,S w((.-@P l0P00ڗPNL ᇚ0@#R0SJ00SPES_ 0P0G $0S> 'P7 ͟P4 N`P/ Ǚ0P 㪨P ?P t `x ;噗 g0@# 列.@p6堨@}0SI`Ph哙o@$@ᗣ0P J$0Sh0T0l巚0P T`P >P 0%P P ZP 0X ?P~ 0\ gPw 0H aPo [f  Ph ǖPb 0( ǡP[ ĕPU უPO PI *PC ᧠P= GP7  OP1  E`P, ᖢ `D40,S w$),P@ T ՜ 0P0050l`S00+ 0Vp0 0P 0Py 0P 0 0P@ JMP P@  0 @0ڦP  p0= P p|P  ӜP (P 㟥@P}  Ɣ0P d`VtkPi t0Q_ ᓧ`P` |"Př il it0  s eP `哤P  Ҟ"p婙FQb w+@PJ 0P00h`@ 0 [: w+P T , *0P00@`@噖Ԙ寗`` R00`( (`@ἤ0P00d400 ` ` @ ”k ጙꨅ D < H 9L  D \ }  d d<l >x  \  0 dS  0ʘP㗔 g 1\զ0`0`J`i(@"ē`P`@ `] r*0P0@@@D 宦 ᵚ@ 妦墦`ꨡ`P` f@`PC 0S% @P P 0R@0Wvc0P004008 hᾕ@@t叠t oPJ@5DTA-@MPK`T VT $10S Ѝe00SPp 傜 V 0 ^&pݣ0P@@ߘ0 |+VV  `0F+V FPNFP h t  O-0"M p @Pm&`P? U@ @ ᗞP@40PʍPPL  0 ḗPJ [ #80S `ޘ@P!ЁW! 孥%T@gЍ茁偔|A 嚥@xVЍ᎘PHAW4!@ 凥<0S@W  y܀W  opՠfbὕP U0 壛 w 0  XPEẠDX 0 x   Ă O-PLM@pD0C!S}>D$0C!S00 =P= 000&@@P>4>@0S "0 0 04, (ܤ W =TP3, Τ@Ҙ<壕@塕D婢%/LЍ}= i/P@*xSd>|孤@ ᔞᝒ + 0D ឤ@ןP,嗤@ח  ፤@IP@᫔㍘<^@\Dd/LЍP^000[3= 2Dj(PT+=0l" @ ;(P 000E=08" < -(P<9=(6=$3 = 000-00* 1 &<P" T^P{p_IpPQV(00 0$0PP Xo0S0A00S040S0 `4`ID00#P@ V`" <Ք@ӔDۡW/t@@@LЍ w D00 @0< @ @d D8 V D tP | x t  OO-pM"<`PdB pppp> P  P  =P92 壣Ѝ`PpP0P0p` pppp P=Ѝ0P00P0 P PP0P 0P% P ٢( $ؓV=Z7Y,X&0S0S 0S0SW 㽢O厠 P嶓㰢B㬢>㨢:㤢6`壓,T埓 㛕㗢)㓢%L < D   p@-PM`?oP20SЍp@ȟX0P`RL Z80P偕 ẕ  0Ѝp蔅  O-0@L)uMD1`p`!HALAPATAXA\AdAhA0P 0CpĹ<08040,0(0$0 00H0D00@00000埑00S  徖H岠尠8叛 n4l@~|Dz(,~ (偠 $~<-Lzuߍ"6':0`Pwx0AA<@\@AT@@P@@@@@@@@@@@L@@@@|@@@@@@t@@@@0@@d@@@X@@4@`@l@@@@@@@@,@(@$@ @h@@@p@@|=0P GS's0HS00 $0S :%P7 $孕P 0L0`=0P80'<P1 ? P1DH]4&S S~]>C 0CS Pp8p4ppHpDpp@ppA:P%S:`l`:PH p8p4ppHpDpp@pp<#<p84HD@:Y/g5P:.`5P|:W/Y5Pu}:qz:n0\0k00hq: ],<b;h_00\e:QPV@]:H ᖡW:`KT:4HQ:EN: px> (0SS ?:(P0,0SD 5:,P&z.:U/5Ps':l.4Pl :V1P䳟@:< c:ZPX :0L0 0S :2P; 应P pX84HD@j9990S890P0%99999X`a`a``0000```````|`999 0 98P 1!1R00`T``P```0`P0T`~``{``x``u``r``o``l0d0i``f000c`````]``Z``W``T0p0Q0t0N PK`\ < DFD    [  d (  @ T p ( ( H  4 p d  H ho7P80d \ Q  R*\0 R00S4x0\ 00;x0s5 0S (80 S/P" 7p1 ڛP p Y00Spb0t  Ux <001d0L1!0P@0 0SS <0!00  d!0P0N 0SppWj0S (2 0P00 0S=0H00D00SX0q Sx U`40SS 40P0 `0S p0 00p^@0` vP 00S p0t d0SdD1sa <察p0SZ 080\0S0p  pތPO 0X p; 80S3 D!r 0R00S 8P  0\001w`!#P 00@ S00$18 004100p140041S 0S ᢙP $1S80S 8噛 ݐPz X0S 4 0XL1P0P40m l0@S@@0S  0S0Sn 0S]$0ST ᚍPJ0Sl0S  ᝚Վ묘륕lזP  ύ~[*X0S] 0Sg p0d t0K 4 P& X0!0@0S0@ 0 0  傜@堖P d0 0#R00S P@ 0` 匐P ̔* ?oR20Sd0S @0S 0SD1,1 S 0R2(Z/  >pP (92l0S `P 圞 (!lRP 4厞nj0P 1 1S1 S 08@0(PP  ޛP  Pз ͓Fpl` ͌PIJ  ֙ޔ  뼋[*<  əؗє[*3a0P 0 p ㄸ84HD@sO0P$0$I0P,07D0P(02h0pp8p4pHpDp@ppR0!D 0x0dx@6 0ꜹ@6 0@6 04D\0S" H0S HP 0 0   `X0S$1Sq D0SDi@Qfbꄺ庝p0S 0S$ 0S0; 0PH0 0D0Z@PpXX 0SR l唝 p 84HD@`0S `僝00p〻{p8p4ppS 0k}ԻfT1S#P1S0S DY0St $\RoY 00S gPH p L1R/p!P H囍Pq8pt0SN YC < , \U"0P803 hP' , 8P,8p`< t j(` Tp8p4ppGpt4pp= p t448t p4-+Pн d0S2D1s/ * p40.0 8>P`8e0 p `D0840 p 㔾D084H p ľ84HD墜 ᛑe $U $ P`00pHT剜0D0p8p4pHpppꈿyp4pp갿o ʌP,10Sq ɑ0S P@Ꮠ0` mPj (0h @lPt |0S`1Sh  Ẋ0S] d0|00SVp -ʚ0 S 0 S 1 S 0 S 1 S 0 S  0 S 0 S 0 S P0 S T0 S 0 SJ 0 S? 0 S  Vk0 S, 0 S" 0 S- 0 S6 0 R S S [p@ᩔ @DPF 1p 9 ႑X 2 H Л ߖ  (ț ֖[pP P N@P 5 ᒍ 徔 ᑎ ᧛ P 7 t埛p 0S,0 00 0-P |0 0`1S (-S L0 S 0S 00S 1H@AҋPӲH*zpvwX s X! / pjK tf ᓘz  h1 ။> ߘ:8 E0VPQ@P 01.⦊ *寔 -  &   Ct  @ p ፚP P;PU, U% ,@7PP͐{ p pP :U U   ܚ ך Ӛ p债L p lh0dJS@p P7 ^ [? 2pដW  嬚l1S@ @T:0 0 堚l1TQᬕP AZꌹp 匚p凚l0Plp } TyG$Ht  ᖘ0쀝㲗10 1ӇP㠏 ]0 ܕ&! ᬐ8孊0P,1bl(寙@P`  0,QQCR CP\(\ (H8@(呆PPY o0 ,RR  CQ  C CPap A,1SC 8ɒ<똓두0P01 P `@E<{P (1`V 0PW pPa A6(@PpE'& l әPp  ᵓa A&P 0 0@廙Yw0P@ 0 奋PJX嬙$00p14000pȵ 坙0p8p4pꜵ咙p4pt则p0Xp0Hp5 0 L1\P 001809믐P dj0 pܴ8480\001X0P0y $ Ppᄴ4 ph40@0p0@0C@; l 6RX0S& <0d 0x40TL10P0L 4ċP 0 0(0 0dh0P;꘳Oꄳ J@ R 0 0(0X0h0P# 剒낏j(3 P첟` p#Բ`|0    0  勑 Ί ' Pʓ &  P0 0 x0P@0S  uPX 0 S 0S0 l1 0  0P@ PJ 1 B  [? !床l1S0rX@.Ж0P0C 0} X\00 ၎ላד[TʀX圓0ꜰ` 4Qꄰ$L݋l`Cꐶ  tq l q t  v 8 & q r H}   t    <=4 p @  I ` T l | @ @ 0  L \ 8 d 00/40/300/3  0S /-t M 0P  塊 P04 0 Ѝ 030YYXA-P@0 0` བྷT! @T" U Upཐ@DpP 妗UA谐PPDAਐ8Aऐ,AࠐuXH_L=H@X4XO-2PQ0MS t 0S X2X0r0SB <"` 0"  ("    BRT  !  P@p!@`p 0 Pp@DXN 0S:! \:x1x 0 `/0SЍDD 44 $$     ๓\0 0 0 ৓Pp@D00ЍtH)HXTW )x<W@(WVVVVV'\V' (@T.Ѝp@舏0 PR 0S* @0xTЍp@p00Ѝp@WTP  LDl&UCQqlUUT.US-PU\T(TTRR0/1@-0@S M L+P 0 0Ѝ@ÍЍ@-(@(@00P,xt0@-0 M0P@P |00P rP  Ѝ0 0Pu)$ 00廄n+R0@-2"0  @MP 0Ѝ0.H\ P#0P@k =0P0f   00T:R T N  s  000  :PR 0 0 0R   0S> 00P Γ0P@  R# 0 0娇0Ѝ0u@/.Ѝ0@d).P 0SfЍ0@3.Ѝ0@T( F0( >(h 70 @( <,0 0 iX+MxRPTQ8QPPP(00/(p@- 0M0 `J0P PᤋP00 R Ѝp00 @d 0`0P40<0 @Ѝp@ʃP\k\(8P0PPO-T1TT M0` 0`0P0?ልp@:WWP/Wp  pOP0@ 嵔唃`0 P嫔劃PU :UP  @ p.P0S :S @pW:W  ЍOTj'O0@-0 P @M @᷏p@ d0d0[ 0壆 0 Ѝ4040@a@@(&h%NM-0 MP 0P00t 0z-u 娓 P0 Ѝ\  0S 0,寇P Ѝ F P0L%hM%0A-pdd^ M{PPM :q@P` 00M`P~0P)  0P/ 夂@} %Ѝ0P@T   0@r  `U0PP\0\@ϓL˓@ $0@@XgLLLLLLKKK0A-pdd^ MPPM : @P` 00`੐P0P)  0圎P/ 啓@} ྅Ѝ0P@T   0婍@r ਅ `0PP\0\@hLd@奁$0@@e@KKJJXJXJJ0V@o/ 00S00S 00S00S H 00S00S ًp@-M@ 0`ᆉP0 堍@PP ׂ }P0SPЍp^PȑPo PPPfA-P@2U0 M R`@@ 岑0Pp0 ׋0 R ! ` 0 0h&0 00 `0反PQ 및0P`L ᠈PPF W 0 7 ề0 mπ ЍAP4 ;; S ~P;S0P2 CP*P( P  AP$ 0P  00凒 0@ᬈm Ѝᦈ@ Ѝ@ Ѝ8  0  (  b IGGFpHO-0 M0p0u`P㮂U%@0-S@ +S@Q Q ᦉP X 0   ሂPU (000 ЍT`/@-@M 0S 嘊PЍQ 0ݑP0 S ᕀP 0SЍȉPЍR 0S 0SPᙈPQ n00 R/|@-@M = 40P@ Ѝ諌Ѝ@-@M  0'0 D0P@ЍhЍ0@- M P@0`x @3P Ѝ0 0RpP% 0~V  `w@Ɋ Ѝ%< kV d`]EEDD 0A-0 pP@P ᤐ`P@ P ၉P@ ᜁPH 0 82 0$0 )DT\PD D0P/- M0a Ѝ9P/- MV  0 Ѝ䱎C_-@-00M (0 @~RZp@-`@@ Pᛏ0P@ pz$0 dC@C0C- MRP@0M R p`m@ 00  @ R 0 !Ѝ S!"R'R 0SS 0SS@pA0S 0S 00  p0 4P  00(P00ЍBAp@-@Pỉ,T T @,T 00  T0 Rp 0      0Q  /SQ D @- @P 0S80/S@-@@P00p@-P@HPp,P00ppt@X@p@-@pPvPpLmP00p(cP00 p@1?QPG- 1`0`PM RPЍ@gp1P#ኈP /p Y z~)} #p ~PP `PP 000卍ЍV0@-@ MPT1 0Q ᢈ0(R S  { Ѝ0@蒈p0午 0 Sႈ4~((  Ѝ0@蜁 Ѝ0L=ip@-@Pᭅ,  p@kO-`4 MP0DP@P < ЍO6\pP0HW0 `ȠȰȀ 02481X ! 1 @ T0p` @02481V *TH  W(0=0=@=0=<<<`<;O- Dp M0PX*XpG `@10 0 "$(!Y*  @Ύ T`@ p` "$(!T* ⼎[ ЍO贎ᱎh @⫎[Hऎ< ➎ X <<<t;`;H; ;:O-pH2M0`Pᯅ@Tf oUQ?o2V0S>D0@ ?o2R0S Ȃ"PK 0@ 0zP@ Ѝ(0P8 U? 0 zPo0 0 0zP1 P65P V" 0 00|Pʠ0P @0St0P|@Ѝ 0Pz 0`| 0 P$QhC-PD1CM0`p-U+ @(@T5 !@0P PP d@P) ׆Y`@`@}CߍP @,ᔉ`0@P@|`@0@@奍$0(@垍N8(<7<7C-l1M0`P@шpΈˈ0pS010S!`ap`0 /PB_0 (ឌPЊ0SSᔌPߍ0`X7|ߍl p`0 KXc~<0H` 0?0W~j8M6664%5%p@-0P@PM 0 -P T$ ᳀0P0Ѝp0Ѝp蕅0P` 0 0P T0  0P00倆0Ѝp0ЍpG-M M p`@P> t#VP 0P00U ; P7 n`P< X@@~ۍЍZ E`P P00 0巌40P{`}|00p0t00壌0L0T0 0噌0$0000同0J73`5330@-@ M0 P0P 0S Ѝ0 0 0 Pt0@!`Z H0@!8O.{ Ѝ0HT 32G-1M0@pP|`yP>p!0 X!0 @B`ۈ (! $0ᲀ`! 'V0 @0؁ ~@syTJ`   V @_yTḁ ~@L  D8A;X)`)`)h)h)(d(((A-pP0 @R,@0 R S `B,\0SC`A0 \ R0^ *00C0,, z z4(H"0"A-PQML R@@p` 0 0,$0S PA 10 |X@@V 0 z$0S P#00 dX@@ 0S  {$0PS P\00X LUЍ400,00$00&&&&<&&|p@-@Mxz@Ѝ@-M P`p' @Q T  (0P% PЍwP |0| ,0 P oL0L  ,0 PB|PPPdt%T%`%p@-@M 0`~0 PDP@ ׅЍp}P@@p@-@M 0`~0 P)P@ ἅЍpLP@@0G-0PRp@  \`{P@wTG(0(@ 劇iv50G-0PRp@  2`P@ wTq@k 0G諆(0(@ [:v4Yy,#0P/- M0s  ЍwyU A-PM`t0QSPP  Y 000p   ,04@zPW 40S:VV0, <8 ł0P0@0:00@l 0D p 8 h 41 H` @0 0@0K Pt}0P$}@,@ %y0 !yPЍVt  x = wt  x =lwPPЍvt` `` rxT =P qwP3p L(o ! g t G-XMPp`@P`9 |0 Sx 0@PD>PH 4P|00P00@L0800,00(@$00 0  ু0S  TNxpZx@|Ѝ' |' `0S 0S# `[ q0Z0X 0WPkZ0S 0S WPi h cVP{0P0S26, `Q @q F5|q46, d`< T0P00S 5, `*oZ: UP0S= 0S UP500Q gd5, `UL(0US00ø0$0PS0000S 0S4, @`20S 0S UPY UP0SeY TP0S+ TPZJ Aq0S 0S TPY0S5`Y" |TP0P`TPy~(0S$0S00Ÿ0[4 ,TP3, `噀h0S1 0S- S `PY0Sm 0S~ SP0S/ p00Sv SP0PTxSP9Z8 hSPs`SP0P- ]DS`PcY1 0SPV0S' 0SW S `PTY6 p0S00 00S R`PDY0PRPRP0S8 RP7R`P/0S 0S0 lRP0SXR`PLR`P0S+ p00S R`PR`P RP0PQPQPY& QPQP 0P Q`P0SL 0R, 0 | @lQPxd100~0S9 DQPS000z%#DLC0_.(LZԞe   @< p P,  <; `:|cPc0c P bD ba9X l8C88tdT7B\t7\PA-p00M,0@01H0PP`# T  nP  ~n0P! H0,0 0  ,0Ѝ00H000H :,0Ѝ }nP,<00P n00H %,]0 A-p (0M @S P`, ! U  ,nP  %n0P 0, @ 0000 000,0Ѝ@@00 ~,0Ѝ xP,<00`m00 ~,H`x@G-MpoؐP 0uw0S% @T"P@ oTewn0S^}P '}P  m P 000ЍGsnpPЍ`G-@}`PP`- A{0g v@0pW|T qP 0h uv`@E|T qP lnsPYp@-P 8M@L4 Q T` L 4   P'.`p48Ѝp4 T `L L H,0O ,0`TA-p 8MPT@Q4 U# T  4`        `,04,0\  %p48Ѝx U T T P,0 ,0@T   `  h\/p@-@00M`,0@0P0PD0 0@0,00 0000 00,TP0Ѝpx@P ,0ЍpL@@00P|l00@ },ho0Ѝp - M ЍO- Wxl0P` Ѝ0S wЍC wy0@P wj0 >zi u0@P wj0 *z i`X0@P wjD0 zhwmAl-0P M -P aQrQ wQ30P0 /lPrQ -s ЍaQ0 P0 `XPP0 80((( sXQ# @-P p0M0@`s 0 gP" 0PP% 0 VpP 00S@ t0t0 0y0ph@hЍ00400r0P00p@-M PhP PЍpq `hP% k ^$ @NF0 PS021 Q, 0 06r84 qkЍp$ jkt | 00C  " /p@-0M0`0P @hP&vP0Ѝpp0P0 (0y0ЍpxTA-@`PpPP T uP.x;uPO U \u0Pp,h0 lP7 Ju@vqP0 0R  xqxoP00xgoPx00xp p xD0\0x(0D0xx@(xl0@- MP+p@P Q noP pPPPWt Ѝ0tPP@- MP`p p@P Q PoP mPPP9t Ѝ "g"b0"LlPP R/- M Fl !  R Ѝp@-`Pp0S @4PP( Mj0Sp@ Dj  O-1 m$0 SePPA Y "mP`E 0$P]P [P cLk`P L[ d0$(2  @02. 0(1 0!1 0P| @<1 001 0q1. 0mi1 0 `iX10}/ A=P 0$@`, }ePA=00U8POST\<h"GET D dpd l   hh p( 0 |4d T  Dl d0/K0-A-dM0A 00P@P.100S% p@ijP` P0 ]j 0O[00c@ |im0  [jcdЍAЍ/0|iP ^` | h,wm[K4nmQ<00/-(0 M 0 ЍxJd0`G-Pp]lX!e널 =mX@d e` 1m@ ,mX(G%m!m,ԁ@-M @`1PQh ,\P @T @@Ѝ@ A$$0Ѝ@0IHt (00uP //////////x/p/h/`/X/P/H/ᐪ$\$x<P~`@-@g @T(0/S@-,00P ' j0 '0舆d@-0PM 4@0@g$ '`0 ,iЍ8/00(/p@-P010C@MCS00  GЍp0S  QiP  JiP CiP  t}xPp@-P'POD1@0 P (! $$$A@Q a`0Qp@Q0P 0P 0CP       x  p  h  `  X  P  l4|<ؽ_ܿl?2?`DXLp@-@PZ` h0P` dT uh`pphpqP U0P`C`p0P @-M@0P Ѝ00 0b0Ѝ0/z800@-P M0 PP Ѝ0g@\t0T U00 Ѝ0DD444.$$(Dy,yyp@-@PY+`% Nf0P` dT Y`pXpP V0P`_p0P @-M@0P Ѝ00 00Ѝ0/x- MPb ЍA-`PP p@P eP00@@Q @$PPQ`wPPp@-`PP @P ePp<<Q $@@Qpv@- MPpe `@ zh 0B?o 2R0S1@s0"S ` ЍP0S J` Ѝ@-M@P00Ѝ - 0 M0,  Ѝu@- MPpe `@ Ig 0B?o 2R0S P1r0:0"S ` Ѝ00S ` Ѝ@- MPp~e `@ wY 0B?o 2R0Sqp 00S` Ѝ0"S` Ѝ@- MPpRe `@ ` 0B?o 2R0Sp P0S` Ѝ0"S` Ѝ 00, 04 /PsA-P`A封@880 R Qb bR b4U@Y[h" 1Sk 4.0Sd P,!R] 4~ RV \^Q eb! s1*R $88S S S400?sp KbR& t$HH AbT  7T4@XE[01ZP >[0T0CT T: T8 T$ $88S S z br0X bi  Td400?spJ(!H!g\k8 ب<DԧTD@-X@X0@0P  @a0 @ O 0@a\lT̥@-4 4 0P@Q  0aRO-`@4Mp\Vc 0 000OPP$ ZX pZUG&'(0, 0 {O&'0 )4;C 0CSe0 4ЍZZU"V&'(0, 0 ]&'0(4;C 0CS#00 h_Z`VXL4ЍOVZ0 ````]PP X FZU,9P /fP hP tP' "a(P W a,9P !fP GP tPh' da(P WH `4 ZU ` 0 00NY& '04;C 0CS0 ,9P; fP2 PL tP& YyxYthYoXYjHYe8Y(YYYYYUI `̕ 0 00\Y& '04;C 0CS0 ,9P CfP P tPD% E<yY`V qYlYgYbY]YXYSYNYIYDY4P  PHl0CP P\$ X#`(P V< `4Pl  P>l0CPd PQ$  `(P V `3P  P(l0CPy P# |3Pt  Pl0CPu Pt# Ih# `3PCX# H3PD# 8# d,# z # 3Pt # 2PT" DV P' _(P& _\" " " {" " u" !V Pox' _(Pn\& _H" ^@" u8" X0" U(" S " k" M" e" G" DU PA' c_(P@& [_! 0! H! EU PB' I_(PA|& A_Fh! 1ꤥth~}=dLD8l|+t8DPPPz)ԠԠԠ8D? TL.+|dH.8.(.,-,, ~t , ,+Ĝ,} |h+|}Px O-@ M`[QP`Qs3p0TS83 ^ZU U0 JWTwQt0 ^0 R00?S @+UOoPBUG$3PE0)UBP +U U2 E0)R  dU0S 0S20 z^ ЍUT0ST Ѝt zWZ \sW P T`0 J(eWT0+U0jU1PE0)UP Z =^ PZ]3^Z ,^ Ph[]p"^0S@Z 0Z 00SZ 0ZZZ0Sl00]gdU0S|]dU0SX]@20s*sD<1 S!  5 t! !S  * S!!  S!  S!  S 0#20 0000 0#20 00000 bg0S |  x 0jUkY \  T  0d\@Pz~~~H!|(}t|H|O-MPBUELCL3@@`I4 8UPP=E`K +U rX 1N`pKpD 0LA#N l0^DP 0WDP{UMPPhЍ0n ADPx n0:DpMW9 1001 0` 0 VKM`W,FV M[ Q R* M0 T[ MoZ' T 0CP  T M T}`Kt {Tm`MsTTT Nk|||4 {| zz4z\z,zXz4tyG-耟`pQ@ MMP  ^IP@ DPKP h0U@ X0 0TC004@6MCPPHhlypy yA-PpR@`L)P@hDTWG-@ p,`8S KPPY P@PB @LP@BDT0 j H@P. 00S:p 0$ 0<(0S/ JPPM (^P@P 0 kH@P@JPP! T PP X EP W pPGG@pPP@F@PpJPP $0S P@P 0S(0S  E@P@p@-H0H 0 @@0@P0B( KMp@WIdd"@-@0@0` MpPB0UV000 Ѝ0EP0  ^APP dcNTHL0 NA0000 +S"ld`uuA-`@mNP ppmEPP rCP `NP AS|ppt S@`YCPKp 0$? I@Ldulup@-P@GPTCP0L $BP4  0p@R  p@R8Ptt0@- MPR@CP?0<0000 0`I0  @ Ѝ0 DO-P,Mp P$PEdP` @,Ѝ\0@0X0 0 00  T0>DP P 0 PU @`T0SX0S\0S$@T `APAU# D@PPDPP@`0sO$00S0Y0S3@*A@$P aJ _J,ЍAP`DaN0  Cp0 0%> (@P LNP. d0S 0`> LPi `0@S` h0S >'Dh0=OPP 20 Q 'DK`0S0\00X0 0$00T0CP^20@fA`NDM0 Bp0j [ @M\0PP p K1DX0PB @AT0P9 P10@0@00DB@ P+A P$ 'AP, #AP6  X! P0S 0QJ400zQ@00+  00P0xp  @`U `?00<  Da}x|{{{p{hz40zzp@-@Q0M0R00`PIP  WO0P T N0U D00>Ѝp@-pTM@P`QP@T@V Q0 P@@  ?Ѝ> PP@@ @T 0S :0KPP0 | PP@@`B/CL  CV 4P@ Pzydyx  yxO-@0MP0q,0DpeP` 0Ѝ$1 0 10,000 ]BP T\ 1SN$1S ,L$1PK,!@, CP,L,<,+B810S0U0S!  # Y0P0  BP s  0 EAPu]  JP%,~H40>?>40TS 0=0  Ѝ,B 1P #TJ,?P G,UH/o04",0P 1[PS? (Aw`Goo,1$!`bpG4/o 0 @"0>020>W,&H20>2 0}D0$ %L P$ Y Y }? Px@20q `@C=GPa P8FPH  K@P01sJ 0CS01000F *<,1$!(!/ P0@y `  @i>>0+00 >>q `@>t00T>> Pg;0  >@p0P0 0 4@PYuwC @-@3FPU;P 0@PS/pG-M@`M8R0PP4 H;0Pp. 0S0S+ 1@"OOBO BO9MP Ѝ0S p10NЍ0S 0S F@P@@nG`lGT P=P  bH`HKI00N R?PV sAP E?P Y 0 @JP  IP  NBP ,H*HISLsLs4s( sDr0@-0@ M0Pᠽ|000 0@fP00ħ Ѝ0<0<0N,r @@XQqqT-Hqp@-@ PRP0`M" \-  0/;P0 0 PNP=000ЍpP00P\?@00< 8NP0 00NPp\pTp0@-P0 MR@00K P0 0 P dCP>0 <0000S   Ѝ0@1D0 0(M  Ѝ0xOo)>p@-PM`kD 0@P@  Y@P00 0;Cd8IЍpL 0D MЍp 0$0MPNLonp@-@Pm<:P 0$p@ Mp@Mnn Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/PFQ @-@A/Q0  aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/PQ @-@A/@-SF@->A AA'A6AAAAAA&AA)AAA A Aapps/lib/cmp_mock_srv.cprofile1mock server received error: pkiStatusInfo absent pkiStatusInfo: %s errorCode absent errorCode: %ld errorDetails absent errorDetails: , wrong certificate to revoke%s: Memory allocation failure %s: Use -help for summary. Unknown item name %s Supported types: %s Error reading PEM file asn1Can't find 'asn1' in '%s' '%s' is out of range Error parsing structure Can't parse %s type Error: offset out of range Error writing output Error parsing item %s apps/asn1parse.cGeneral options: helpDisplay this summaryoidfile of extra oid definitionsI/O options: informinput format - one of DER PEM B64output file (output format is always DER)nooutdo not produce any outputoffsetoffset into filelengthlength of section in filestrparseoffset; a series of these can be used to 'dig'into multiple ASN1 blob wrappingsgenstrstring to generate ASN1 structure fromgenconffile to generate ASN1 structure fromstrictpemequivalent to '-inform pem' (obsolete)itemitem to parse and print(-inform will be ignored)Formatting options: indents the outputdlimitdump the first arg bytes of unknown data in hex formCAkeyTimekeyTimeholdInstructionapps/ca.cAdding Entry with serial number %s to DB for %s Vrow exp_dataunknownrow ptrfailed to update database TXT_DB error number %ld ERROR:name does not match %s ERROR:Already present, serial number %s ERROR:Already revoked, serial number %s Revoking Certificate %s. Unknown CRL reason %s Invalid object identifier %s Invalid time format %s. Need YYYYMMDDHHMMSSZ revocation reasonError in revocation arguments variable lookup failed for %s::%s NULL invalid type, Database error undefThe Subject's Distinguished Name is as follows emailAddress type needs to be of type IA5STRING The string contains characters that are illegal for the ASN.1 type PRINTABLE:'T61STRING:'IA5STRING:'UNIVERSALSTRING:'ASN.1 %2d:'\0x%02X^%c%s:unknown object type in 'policy' configuration optionalsuppliedThe %s field needed to be supplied and was missing matchThe mandatory %s field was missing The %s field does not exist in the CA certificate, the 'policy' is misconfigured The %s field is different between CA certificate (%s) and the request (%s) %s:invalid type in 'policy' configuration Everything appears to be ok, creating and signing the certificate Warning: Signature key and public key of cert do not match Extra configuration file found Error adding certificate extensions from extfile section %s Successfully added extensions from file. The subject name appears to be ok, checking database for clashes ERROR: adding extensions from request Error adding certificate extensions from config section %s Successfully added extensions from config ERROR:There is already a certificate for %s ERROR:Serial number %s has already been issued, check the database/serial_file for corruption The matching entry has the following details Type :%s Was revoked on:%s Expires on :%s Serial Number :%s File name :%s Subject Name :%s Certificate Details: Certificate is to be certified until (%ld days)Sign the certificate? [y/n]:CERTIFICATE WILL NOT BE CERTIFIED: I/O error CERTIFICATE WILL NOT BE CERTIFIED row expdaterow spacecertificate requestError unpacking public key Check that the request matches the signature Certificate request and CA private key do not match Signature verification problems... Signature did not match the certificate request Signature ok %s=Expired memory allocation failure invalid revocation date %s missing hold instruction invalid object identifier %s missing compromised time invalid compromised time %s invalid reason code %s default_caoid_filestring_maskInvalid global string mask setting %s utf8yesunique_subjectdatabaseProblem with index file: %s (could not load/parse file) row serial#Serial %s not present in db. %s=Valid (%c) %s=Revoked (%c) %s=Expired (%c) %s=Suspended (%c) %s=Unknown (%c). Error verifying serial %s! private_keyError getting password CA certificate and CA private key do not match preservemsie_hackname_optInvalid name options: "%s" cert_optInvalid certificate options: "%s" copy_extensionsInvalid extension copy option: "%s" new_certs_dirthere needs to be defined a directory for new certificate to be placed in %s: %s is not a directory entry %d: not revoked yet, but has a revocation date entry %d: invalid expiry date entry %d: bad serial number length (%d) entry %d: bad char 0%o '%c' in serial number %d entries loaded from the database generating index Updating %s ... Malloc failure No entries found to mark expired newDone. %d entries marked as expired Successfully loaded extensions file %s UNDEFdefault_mdno default digest email_in_dnnomessage digest is %s policy is %s rand_serialError checking certificate extensions from extfile section %s x509_extensionsError checking certificate extension config section %s default_startdatedefault_enddatedefault_dayscannot lookup how many days to certify for Warning: -enddate or -not_after option overriding -days option error generating serial number error while loading serial number next serial number is 00 next serial number is %s unable to find 'section' for %s error on line %ld of %s no name/value pairs found in %s unable to load Netscape SPKAC structure Netscape SPKAC structure not found in %s Check that the SPKAC request matches the signature error unpacking SPKAC public key signature verification failed on SPKAC public key template certificateerror unpacking public key Signature verification problems.... Signature did not match the certificate %d out of %d certificate requests certified, commit? [y/n]CERTIFICATION CANCELED: I/O error CERTIFICATION CANCELED Write out database with %d new entries writing new certificates certificate file name too long writing %s wDatabase updated crl_extensionsError checking CRL extension section %s crlnumbererror while loading CRL number default_crl_daysdefault_crl_hourscannot lookup how long until the next CRL is issued making CRL error setting CRL lastUpdate error setting CRL nextUpdate signing CRL Error adding CRL extensions from section %s no input files certificate to be revoked in entry %d ExpiredRevokedValidunspecifiedkeyCompromiseCACompromiseaffiliationChangedsupersededcessationOfOperationremoveFromCRLUsage: %s [options] [certreq...] verboseVerbose output during processingquietTerse output during processingoutdirWhere to put output certThe input cert request(s)CSR input format to use (PEM or DER; by default try PEM first)infilesThe last argument, requests to processWhere to put the output file(s)dateoptDatetime format used for printing. (rfc_822/iso_8601). Default is rfc_822.notextDo not print the generated certificatebatchDon't ask questionsmsie modifications to handle all Universal Stringsss_certFile contains a self signed cert to signspkacFile contains DN and signed public key and challengeUse engine, possibly a hardware deviceConfiguration options: A config fileThe particular CA definition to useAn alias for -nameThe CA 'policy' to supportCertificate options: subjUse arg instead of request's subjectInput characters are UTF8; default ASCIIcreate_serialIf reading serial fails, create a new random serialAlways create a random serial; do not store itmultivalue-rdnDeprecated; multi-valued RDNs support is always on.[CC]YYMMDDHHMMSSZ value for notBefore certificate fieldnot_beforeAn alias for -startdate[CC]YYMMDDHHMMSSZ value for notAfter certificate field, overrides -daysnot_afterAn alias for -enddateNumber of days from today to certify the cert forExtension section (override value in config file)extfileConfiguration file with X509v3 extensions to addpreserveDNDon't re-order the DNnoemailDNDon't add the EMAIL field to the DNSigning options: Digest to use, such as sha256The CA private keykeyformPrivate key file format (ENGINE, other values ignored)Key and cert input file pass phrase sourceKey to decrypt the private key or cert files if encrypted. Better use -passinThe CA certcertformCertificate input format (DER/PEM/P12); has no effectselfsignSign a cert with the key associated with itsigoptSignature parameter in n:v formvfyoptVerification parameter in n:v formRevocation options: gencrlGenerate a new CRLAdd a Valid(not-revoked) DB entry about a cert (given in file)Shows cert status given the serial numberupdatedbUpdates db for expired certcrlextsCRL extension section (override value in config file)crl_reasoncrl_holdthe hold instruction, an OID. Sets revocation reason to certificateHoldcrl_compromisesets compromise time to val and the revocation reason to keyCompromisecrl_CA_compromisesets compromise time to val and the revocation reason to CACompromisecrl_lastupdateSets the CRL lastUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)crl_nextupdateSets the CRL nextUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)crldaysDays until the next CRL is duecrlhoursHours until the next CRL is duecrlsecSeconds until the next CRL is duerevokeRevoke a cert (given in file)Random state options: randLoad the given file(s) into the random number generatorwriterandWrite random data to the specified fileProvider options: provider-pathProvider load path (must be before 'provider' argument if required)providerProvider to load (can be specified multiple times)provparamSet a provider key-value parameterpropqueryProperty query used when fetching algorithmsParameters: certreqCertificate requests to be signed (optional)UNKNOWNOpenSSL cipher name: %s Error setting TLSv1.3 ciphersuites Error in cipher list 0x%02X,0x%02X,0x%02X,0x%02X - 0x%02X,0x%02X - %-45s - Usage: %s [options] [cipher] Output options: Verbose listing of the SSL/TLS ciphersEven more verbosestdnameShow standard cipher namesconvertConvert standard name into OpenSSL nameCipher specification options: Only supported cipherstls1Ciphers compatible with TLS1tls1_1Ciphers compatible with TLS1.1tls1_2Ciphers compatible with TLS1.2tls1_3Ciphers compatible with TLS1.3pskInclude ciphersuites requiring PSK(deprecated) Include ciphersuites requiring SRPciphersuitesConfigure the TLSv1.3 ciphersuites to useCipher string to decode (optional)error setting verification parameters for %s apps/cmp.c%s:%s:%d:CMP %s: NULL arg to write_PKIMESSAGE%s%s%s %s:%s:%d:CMP %s: not enough file names provided for writing PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot write PKIMessage to file '%s'%s%s %s:%s:%d:CMP %s: not enough file names provided for reading PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot read PKIMessage from file '%s'%s%s %s:%s:%d:CMP %s: %s %s%s %s:%s:%d:CMP %s: cannot write request PKIMessage to file '%s'%s%s actually sendingactually using%s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to using mock server%s%s%s warning%s:%s:%d:CMP %s: missing -server or -use_mock_srv option, or too few -rspin filename arguments%s%s%s %s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to contacting server%s%s%s deletingwriting%s:%s:%d:CMP %s: received %d %s certificate(s), saving to file '%s' %s:%s:%d:CMP %s: saving more than one certificate in non-PEM format%s%s%s %s:%s:%d:CMP %s: could not open file '%s' for %s %s certificate(s) error: unsupported type '%s' for writing certificates %s:%s:%d:CMP %s: cannot write %s certificate to file '%s'%s %s:%s:%d:CMP %s: using only first %d characters of section name starting with "%.*s" %s:%s:%d:CMP %s: %s option argument is empty string, resetting option%s%s %s:%s:%d:CMP %s: %s option argument starts with hyphen%s%s %s certificate%s:%s:%d:CMP %s: Failed to delete %s, which should be done to indicate there is no %s%s %s:%s:%d:CMP %s: Logging verbosity level %d out of range (0 .. 8)%s%s %s:%s:%d:CMP %s: -keep_alive argument must be 0, 1, or 2%s%s%s %s:%s:%d:CMP %s: invalid popo spec. Valid values are -1 .. 2%s%s%s %s:%s:%d:CMP %s: invalid revreason. Valid values are -1 .. 6, 8 .. 10%s%s%s %s:%s:%d:CMP %s: must give -srv_ref for mock server if no -srv_cert given%s%s%s PBMAC secret of mock server%s:%s:%d:CMP %s: server credentials (-srv_secret or -srv_cert) must be given if -use_mock_srv or -port is used%s%s%s %s:%s:%d:CMP %s: server will not be able to handle PBM-protected requests since -srv_secret is not given%s%s%s %s:%s:%d:CMP %s: must give both -srv_cert and -srv_key options or neither%s%s%s signer certificate of the mock serverprivate key for mock server certcerts trusted by mock server%s:%s:%d:CMP %s: mock server will not be able to handle signature-protected requests since -srv_trusted is not given%s%s%s untrusted certificates for mock serverreference cert to be expected by the mock server%s:%s:%d:CMP %s: no -rsp_cert given for mock server%s%s%s cert the mock server returns on certificate requestsprivate key for enrollment certCRL to be returned by the mock serverCMP extra certificates for mock servercaPubs for mock serverNewWithNew cert the mock server returns in rootCaKeyUpdateNewWithOld cert the mock server returns in rootCaKeyUpdateOldWithNew cert the mock server returns in rootCaKeyUpdate%s:%s:%d:CMP %s: -failure out of range, should be >= 0 and <= %d%s%s %s:%s:%d:CMP %s: -failurebits overrides -failure%s%s%s %s:%s:%d:CMP %s: -failurebits out of range%s%s%s , and -key option superseded by -csrfallback public key for cert to be enrolledpublic key for checking cert resulting from p10crreference certificate (oldcert)certificate to be updated%s:%s:%d:CMP %s: no -subject given; no -csr or -oldcert or -cert available for fallback%s%s%s %s:%s:%d:CMP %s: out of memory%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) to be certified and no -csr, -oldcert, -cert, or -reqin option given, which could provide fallback public key. Neither central key generation is requested.%s%s%s %s:%s:%d:CMP %s: POPO is disabled, which implies -centralkeygen%s%s%s %s:%s:%d:CMP %s: -popo value %d is inconsistent with -centralkeygen%s%s %s:%s:%d:CMP %s: -newkeyout not given, nowhere to save centrally generated key%s%s%s %s:%s:%d:CMP %s: no -newkey option given with private key for POPO, -csr option provides just public key%s%s%s %s:%s:%d:CMP %s: since -reqin is used, may use -popo -1 or -popo 0 to disable the needless generation of a POPO%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) option for key to be certified and for POPO%s%s%s %s:%s:%d:CMP %s: -certout not given, nowhere to save newly enrolled certificate%s%s%s %s:%s:%d:CMP %s: -subject %s since sender is taken from -ref or -cert%s%s option is ignored for commands other than 'ir', 'cr', and 'kur'%s:%s:%d:CMP %s: -issuer %s and 'rr'%s%s %s:%s:%d:CMP %s: -reqexts %s%s%s %s:%s:%d:CMP %s: -san_nodefault %s%s%s %s:%s:%d:CMP %s: -sans %s%s%s %s:%s:%d:CMP %s: -policies %s%s%s %s:%s:%d:CMP %s: -policy_oids %s%s%s %s:%s:%d:CMP %s: -popo %s%s%s %s:%s:%d:CMP %s: -popo -1 or -centralkeygen %s%s%s %s:%s:%d:CMP %s: -newkeyout %s%s%s %s:%s:%d:CMP %s: -implicit_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -disable_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -certout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -chainout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: missing -oldcert for certificate to be updated and no -csr given%s%s%s %s:%s:%d:CMP %s: given -subject '%s' overrides the subject of '%s' for KUR%s %s:%s:%d:CMP %s: missing -oldcert or -issuer and -serial for certificate to be revoked and no -csr given%s%s%s %s:%s:%d:CMP %s: ignoring -csr since certificate to be revoked is given%s%s%s %s:%s:%d:CMP %s: Must give both -issuer and -serial options or neither%s%s%s %s:%s:%d:CMP %s: Ignoring -oldcert since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: Ignoring -csr since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: cannot read serial number: '%s'%s%s %s:%s:%d:CMP %s: Ignoring -serial for command other than 'rr'%s%s%s %s:%s:%d:CMP %s: missing PKCS#10 CSR for p10cr%s%s%s %s:%s:%d:CMP %s: missing -recipient, -srvcert, -issuer, -oldcert or -cert; recipient for any requests not covered by -reqin will be set to "NULL-DN"%s%s%s %s:%s:%d:CMP %s: -newkeypass %s%s%s option is ignored for 'p10cr', 'rr', and 'genm' commands%s:%s:%d:CMP %s: -newkey %s%s%s %s:%s:%d:CMP %s: -days %s%s%s %s:%s:%d:CMP %s: -out_trusted %s%s%s new private key for cert to be enrolled%s:%s:%d:CMP %s: failed to load ir/cr/kur file '%s' attempting to get fallback public key%s%s %s:%s:%d:CMP %s: failed to get fallback public key from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: failed to get fallback public key obtained from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: could not set requested cert validity period%s%s%s %s:%s:%d:CMP %s: cannot have policies both via -policies and via -policy_oids%s%s%s %s:%s:%d:CMP %s: -csr option is ignored for 'genm' command%s%s%s PKCS#10 CSR%s:%s:%d:CMP %s: cannot load certificate request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot load policy cert request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot have Subject Alternative Names both via -reqexts and via -sans%s%s%s %s:%s:%d:CMP %s: bad syntax of %s '%s'%s Subject Alternative Name%s:%s:%d:CMP %s: -opt_san_nodefault has no effect when -sans is used%s%s%s %s:%s:%d:CMP %s: -opt_policy_oids_critical has no effect unless -policy_oids is given%s%s%s %s:%s:%d:CMP %s: Invalid -policy_oids arg '%s'%s%s %s:%s:%d:CMP %s: Unknown -policy_oids arg: %.40s%s%s %s:%s:%d:CMP %s: cannot add policy with OID '%s'%s%s %s:%s:%d:CMP %s: -oldcert option is ignored for 'genm' command%s%s%s only if -rspin argument gives too few filenamesno server%s:%s:%d:CMP %s: missing -server or -use_mock_srv or -rspin option%s%s%s %s:%s:%d:CMP %s: ignoring -proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: ignoring -no_proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: cannot parse -server URL: %s%s%s %s:%s:%d:CMP %s: assuming -tls_used since -server URL indicates HTTPS%s%s%s http%s://%s:%s/%s via %skur%s:%s:%d:CMP %s: unknown cmp command '%s'%s%s %s:%s:%d:CMP %s: no cmp command to execute%s%s%s %s:%s:%d:CMP %s: unknown option given for key loading format%s%s%s %s:%s:%d:CMP %s: unknown option given for certificate storing format%s%s%s %s:%s:%d:CMP %s: unknown option given for CRL storing format%s%s%s %s:%s:%d:CMP %s: no -infotype option given for genm%s%s%s %s:%s:%d:CMP %s: -infotype option is ignored for commands other than 'genm'%s%s%s %s:%s:%d:CMP %s: unknown OID name in -infotype option%s%s%s %s:%s:%d:CMP %s: -oldwithold %s%s%s option is ignored unless -cmd 'genm' and -infotype rootCaCert is given%s:%s:%d:CMP %s: -newwithnew %s%s%s %s:%s:%d:CMP %s: -newwithold %s%s%s %s:%s:%d:CMP %s: -oldwithnew %s%s%s %s:%s:%d:CMP %s: -template %s%s%s option is ignored unless -cmd 'genm' and -infotype 'certReqTemplate' is given%s:%s:%d:CMP %s: -keyspec %s%s%s %s:%s:%d:CMP %s: missing -template option for genm with infotype certReqTemplate%s%s%s untrusted certificates%s:%s:%d:CMP %s: -trusted option is ignored since -srvcert option is present%s%s%s %s:%s:%d:CMP %s: -recipient option is ignored since -srvcert option is present%s%s%s directly trusted CMP server certificatecerts trusted by clienttrusted certs for verifying newly enrolled cert%s:%s:%d:CMP %s: -total_timeout argument = %d must not be < %d (-msg_timeout)%s %s:%s:%d:CMP %s: -reqin is ignored since -rspin is present%s%s%s %s:%s:%d:CMP %s: -reqin_new_tid is ignored since -reqin is not present%s%s%s %s:%s:%d:CMP %s: missing -tls_key option%s%s%s %s:%s:%d:CMP %s: missing -tls_cert option%s%s%s trusted TLS certs%s:%s:%d:CMP %s: -tls_used given without -tls_trusted; will not authenticate the TLS server%s%s%s TLS client certificate (optionally with chain)%s:%s:%d:CMP %s: unable to use client TLS certificate file '%s'%s%s %s:%s:%d:CMP %s: could not add untrusted cert to TLS client cert chain%s%s%s %s:%s:%d:CMP %s: trying to build cert chain for own TLS cert%s%s%s debug%s:%s:%d:CMP %s: success building cert chain for own TLS cert%s%s%s %s:%s:%d:CMP %s: could not build cert chain for own TLS cert%s%s%s extra certificates for TLSerror: unable to add TLS extra certs TLS client private key%s:%s:%d:CMP %s: TLS private key '%s' does not match the TLS certificate '%s' %s %s:%s:%d:CMP %s: unable to use TLS client private key '%s'%s%s %s:%s:%d:CMP %s: -tls_used given without -tls_key; cannot authenticate to the TLS server%s%s%s %s:%s:%d:CMP %s: must give -key or -secret unless -unprotected_requests is used%s%s%s %s:%s:%d:CMP %s: must give -ref if no -cert and no -subject given%s%s%s %s:%s:%d:CMP %s: must give both -cert and -key options or neither%s%s%s PBMAC%s:%s:%d:CMP %s: -cert and -key not used for protection since -secret is given%s%s%s private key for CMP client certificate%s:%s:%d:CMP %s: will not authenticate server due to missing -secret, -trusted, or -srvcert%s%s%s CMP client certificate (optionally with chain)trusted certs for verifying own CMP signer cert%s:%s:%d:CMP %s: -own_trusted option is ignored without -cert%s%s%s extra certificates for CMP%s:%s:%d:CMP %s: digest algorithm name not recognized: '%s'%s%s %s:%s:%d:CMP %s: digest algorithm name not supported: '%s'%s%s %s:%s:%d:CMP %s: MAC algorithm name not recognized: '%s'%s%s recipientexpected sender%s:%s:%d:CMP %s: Missing ':' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Invalid OID in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unknown OID in -geninfo arg: %.40s%s%s int:str:%s:%s:%d:CMP %s: Cannot parse int in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Missing ',' or end of -geninfo arg after int at %.40s%s%s %s:%s:%d:CMP %s: Missing 'int:' or 'str:' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unable to create 'OSSL_CMP_ITAV' structure%s%s%s %s:%s:%d:CMP %s: Failed to add ITAV for geninfo of the PKI message header%s%s%s %s:%s:%d:CMP %s: will contact %s%s%s id-it-verbosity from %s:%s:%d:CMP %s: using section(s) '%s' of OpenSSL configuration file '%s'%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'; will thus use just [default] and unnamed section if present%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'%s assertion failed: OSSL_NELEM(cmp_vars) == n_options + OPT_PROV__FIRST + 1 - OPT_PROV__LAST + OPT_R__FIRST + 1 - OPT_R__LAST + OPT_V__FIRST + 1 - OPT_V__LASTNon-positive number "%ld" for config option -%s Negative number "%ld" for config option -%s %s:%s:%d:CMP %s: internal: unsupported type '%c' for option '%s'%s -%s%s:%s:%d:CMP %s: for option '%s' in config file section '%s'%s %s:%s:%d:CMP %s: cannot load engine %s%s%s %s:%s:%d:CMP %s: cannot set up error reporting and logging for %s%s%s %s:%s:%d:CMP %s: -tls_used given without any other TLS options%s%s%s %s:%s:%d:CMP %s: ignoring TLS options(s) since -tls_used is not given%s%s%s %s:%s:%d:CMP %s: -tls_used option not supported with -port option%s%s%s %s:%s:%d:CMP %s: The -port option excludes -server and -use_mock_srv%s%s%s %s:%s:%d:CMP %s: The -port option does not support -reqin and -reqout%s%s%s %s:%s:%d:CMP %s: The -port option does not support -rspin and -rspout%s%s%s %s:%s:%d:CMP %s: cannot use both -server and -use_mock_srv options%s%s%s %s:%s:%d:CMP %s: ignoring -tls_used option since -use_mock_srv is given or -server is not given%s%s%s pkix/Not Found%s:%s:%d:CMP %s: expecting empty path or 'pkix/' but got '%s'%s%s Internal Server Errorapplication/pkixcmp%s:%s:%d:CMP %s: -server %s%s%s option is ignored since -reqout_only option is given%s:%s:%d:CMP %s: -use_mock_srv %s%s%s %s:%s:%d:CMP %s: -reqout %s%s%s %s:%s:%d:CMP %s: -rspin %s%s%s %s:%s:%d:CMP %s: -rspout %s%s%s %s:%s:%d:CMP %s: -server option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: -use_mock_srv option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: cannot set up CMP context%s%s%s %s:%s:%d:CMP %s: Missing -cacertsout option for -infotype caCerts%s%s%s %s:%s:%d:CMP %s: no CA certificates provided by server%s%s%s CA%s:%s:%d:CMP %s: Failed to store CA certificates from genp in %s%s%s %s:%s:%d:CMP %s: Missing -newwithnew option for -infotype rootCaCert%s%s%s %s:%s:%d:CMP %s: No -oldwithold given, will use all certs given with -trusted as trust anchors for verifying the newWithNew cert%s%s%s OldWithOld cert for genm with -infotype rootCaCert%s:%s:%d:CMP %s: no root CA certificate update available%s%s%s %s:%s:%d:CMP %s: oldWithNew certificate received in genp for verifying oldWithOld, but oldWithOld was not provided%s%s%s NewWithNew cert from genpNewWithOld cert from genpOldWithNew cert from genp%s:%s:%d:CMP %s: Missing -oldcrl and no -crlcert given for -infotype crlStatusList%s%s%s %s:%s:%d:CMP %s: Missing -crlout for -infotype crlStatusList%s%s%s Cert for genm with -infotype crlStatusListCRL for genm with -infotype crlStatusList%s:%s:%d:CMP %s: -oldcrl and -crlcert have different issuer%s%s%s %s:%s:%d:CMP %s: no CRL update available%s%s%s CRL from genp of type 'crls'%s:%s:%d:CMP %s: received %s, saving to file '%s'%s %s:%s:%d:CMP %s: could not open file '%s' for writing %s%s error: unsupported type '%s' for writing CRLs %s:%s:%d:CMP %s: cannot write %s to file '%s'%s %s:%s:%d:CMP %s: no certificate request template available%s%s%s certTemplate from genpwb%s:%s:%d:CMP %s: error saving certTemplate from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving certTemplate from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored certTemplate from genp to file '%s'%s%s %s:%s:%d:CMP %s: No %s%s%s specifications contained in keySpec from genp%s:%s:%d:CMP %s: Out of memory - cannot dump key %s%s%s Key %s: Key algorithm: - Key algorithm: RSA %d Invalid key spec: %s End of key %s%s:%s:%d:CMP %s: %.*s%s %s:%s:%d:CMP %s: no key specifications available%s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored keySpec from genp to file '%s'%s%s %s:%s:%d:CMP %s: No specific support for -infotype %s available%s%s %s:%s:%d:CMP %s: Failed to create genm for -infotype %s%s%s %s:%s:%d:CMP %s: genp does not contain any ITAV%s%s%s %s:%s:%d:CMP %s: could not get ITAV #%d from genp%s%s %s:%s:%d:CMP %s: error parsing type of ITAV #%d from genp%s%s %s:%s:%d:CMP %s: ITAV #%d from genp infoType=%s%s %s:%s:%d:CMP %s: Did not receive response on genm or genp is not valid%s%s%s PKIStatusInfo buf%s:%s:%d:CMP %s: received%s%s %s validated servernewly enrolled cert and chainnewly enrolledCentrally generated private key passwordAES-256-CBC%s:%s:%d:CMP %s: saving centrally generated key to file '%s'%s%s Configuration file to use. "" = none. Default from env variable OPENSSL_CONFSection(s) in config file to get options from. "" = 'default'. Default 'cmp'Log level; 3=ERR, 4=WARN, 6=INFO, 7=DEBUG, 8=TRACE. Default 6 = INFOGeneric message options: cmdCMP request to send: ir/cr/kur/p10cr/rr/genminfotypeInfoType name for requesting specific info in genm, with specific supportfor 'caCerts' and 'rootCaCert'profileCertificate profile name to place in generalInfo field of request PKIHeadergeninfoComma-separated list of OID and value to place in generalInfo PKIHeaderof form :int: or :str:, e.g. '1.2.3.4:int:56789, id-kp:str:name'File to save certTemplate received in genp of type certReqTemplatekeyspecOptional file to save Key specification received in genp of type certReqTemplateCertificate enrollment options: newkeyPrivate or public key for the requested cert. Default: CSR key or client keynewkeypassNew private key pass phrase sourcecentralkeygenRequest central (server-side) key generation. Default is local generationnewkeyoutFile to save centrally generated key, in PEM formatDistinguished Name (DN) of subject to use in the requested cert templateFor kur, default is subject of -csr arg or reference cert (see -oldcert)this default is used for ir and cr only if no Subject Alt Names are setRequested validity time of the new certificate in number of daysreqextsName of config file section defining certificate request extensions.Augments or replaces any extensions contained CSR given with -csrsansSubject Alt Names (IPADDR/DNS/URI) to add as (critical) cert req extensionsan_nodefaultDo not take default SANs from reference certificate (see -oldcert)policiesName of config file section defining policies certificate request extensionpolicy_oidsPolicy OID(s) to add as policies certificate request extensionpolicy_oids_criticalFlag the policy OID(s) given with -policy_oids as criticalpopoProof-of-Possession (POPO) method to use for ir/cr/kur where-1 = NONE, 0 = RAVERIFIED, 1 = SIGNATURE (default), 2 = KEYENCcsrPKCS#10 CSR file in PEM or DER format to convert or to use in p10crout_trustedCertificates to trust when verifying newly enrolled certificatesimplicit_confirmRequest implicit confirmation of newly enrolled certificatesdisable_confirmDo not confirm newly enrolled certificate w/o requesting implicitconfirmation. WARNING: This leads to behavior violating RFC 4210certoutFile to save newly enrolled certificatechainoutFile to save the chain of newly enrolled certificateCertificate enrollment and revocation options: oldcertCertificate to be updated (defaulting to -cert) or to be revoked in rr;also used as reference (defaulting to -cert) for subject DN and SANs.Issuer is used as recipient unless -recipient, -srvcert, or -issuer givenDN of the issuer to place in the certificate template of ir/cr/kur/rr;also used as recipient if neither -recipient nor -srvcert are givenSerial number of certificate to be revoked in revocation request (rr)revreasonReason code to include in revocation request (rr); possible values:0..6, 8..10 (see RFC5280, 5.3.1) or -1. Default -1 = none includedMessage transfer options: [http[s]://]address[:port][/path] of CMP server. Default port 80 or 443.address may be a DNS name or an IP address; path can be overridden by -pathproxy[http[s]://]address[:port][/path] of HTTP(S) proxy to use; path is ignoredno_proxyList of addresses of servers not to use HTTP(S) proxy forDefault from environment variable 'no_proxy', else 'NO_PROXY', else noneDN of CA. Default: subject of -srvcert, -issuer, issuer of -oldcert or -certHTTP path (aka CMP alias) at the CMP server. Default from -server, else "/"keep_alivePersistent HTTP connections. 0: no, 1 (the default): request, 2: requiremsg_timeoutNumber of seconds allowed per CMP message round trip, or 0 for infinitetotal_timeoutOverall time an enrollment incl. polling may take. Default 0 = infiniteServer authentication options: Certificates to use as trust anchors when verifying signed CMP responsesunless -srvcert is givenIntermediate CA certs for chain construction for CMP/TLS/enrolled certssrvcertServer cert to pin and trust directly when verifying signed CMP responsesexpect_senderDN of expected sender of responses. Defaults to subject of -srvcert, if anyignore_keyusageIgnore CMP signer cert key usage, else 'digitalSignature' must be allowedunprotected_errorsAccept missing or invalid protection of regular error messages and negativecertificate responses (ip/cp/kup), revocation responses (rp), and PKIConfWARNING: This setting leads to behavior allowing violation of RFC 4210no_cache_extracertsDo not keep certificates received in the extraCerts CMP message fieldsrvcertoutFile to save the server cert used and validated for CMP response protectionextracertsoutFile to save extra certificates received in the extraCerts fieldcacertsoutFile to save CA certs received in caPubs field or genp with id-it-caCertsoldwitholdRoot CA certificate to request update for in genm of type rootCaCertFile to save NewWithNew cert received in genp of type rootCaKeyUpdateFile to save NewWithOld cert received in genp of type rootCaKeyUpdateFile to save OldWithNew cert received in genp of type rootCaKeyUpdatecrlcertcertificate to request a CRL for in genm of type crlStatusListoldcrlCRL to request update for in genm of type crlStatusListcrloutFile to save new CRL received in genp of type 'crls'Client authentication options: Reference value to use as senderKID in case no -cert is givenPrefer PBM (over signatures) for protecting msgs with given password sourceClient's CMP signer certificate; its public key must match the -key argumentThis also used as default reference for subject DN and SANs.Any further certs included are appended to the untrusted certsown_trustedOptional certs to verify chain building for own CMP signer certCMP signer private key, not used when -secret givenClient private key (and cert and old cert) pass phrase sourceDigest to use in message protection and POPO signatures. Default "sha256"MAC algorithm to use in PBM-based message protection. Default "hmac-sha1"Certificates to append in extraCerts field of outgoing messages.This can be used as the default CMP signer cert chain to includeunprotected_requestsSend request messages without CMP-level protectionCredentials format options: Format (PEM or DER) to use when saving a certificate to a file. Default PEMcrlformFormat (PEM or DER) to use when saving a CRL to a file. Default DERFormat of the key input (ENGINE, other values ignored)otherpassPass phrase source potentially needed for loading certificates of othersUse crypto engine with given identifier, possibly a hardware device.Engines may also be defined in OpenSSL config file engine section.TLS connection options: tls_usedEnable using TLS (also when other TLS options are not set)tls_certClient's TLS certificate. May include chain to be provided to TLS servertls_keyPrivate key for the client's TLS certificatetls_keypassPass phrase source for the client's private TLS key (and TLS cert)tls_extraExtra certificates to provide to TLS server during TLS handshaketls_trustedTrusted certificates to use for verifying the TLS server certificate;this implies hostname validationtls_hostAddress to be checked (rather than -server) during TLS hostname validationClient-side debugging options: Do not interactively prompt for input when a password is required etc.repeatInvoke the transaction the given positive number of times. Default 1Take sequence of CMP requests to send to server from file(s)reqin_new_tidUse fresh transactionID for CMP requests read from -reqinreqoutSave sequence of CMP requests created by the client to file(s)reqout_onlySave first CMP request created by the client to file and exitrspinProcess sequence of CMP responses provided in file(s), skipping serverrspoutSave sequence of actually used CMP responses to file(s)use_mock_srvUse internal mock server at API level, bypassing socket-based HTTPMock server options: Act as HTTP-based mock server listening on given portmax_msgsmax number of messages handled by HTTP mock server. Default: 0 = unlimitedsrv_refReference value to use as senderKID of server in case no -srv_cert is givensrv_secretPassword source for server authentication with a pre-shared key (secret)srv_certCertificate of the serversrv_keyPrivate key used by the server for signing messagessrv_keypassServer private key (and cert) pass phrase sourcesrv_trustedTrusted certificates for client authenticationsrv_untrustedIntermediate certs that may be useful for verifying CMP protectionref_certCertificate to be expected for rr and any oldCertID in kur messagesrsp_certCertificate to be returned as mock enrollment resultrsp_keyPrivate key for the certificate to be returned as mock enrollment resultKey to be returned for central key pair generationrsp_keypassResponse private key (and cert) pass phrase sourcersp_crlCRL to be returned in genp of type crlsrsp_extracertsExtra certificates to be included in mock certification responsesrsp_capubsCA certificates to be included in mock ip responsersp_newwithnewNew root CA certificate to include in genp of type rootCaKeyUpdatersp_newwitholdNewWithOld transition cert to include in genp of type rootCaKeyUpdatersp_oldwithnewOldWithNew transition cert to include in genp of type rootCaKeyUpdatepoll_countNumber of times the client must poll before receiving a certificatecheck_afterThe check_after value (time to wait) to include in poll responsegrant_implicitconfGrant implicit confirmation of newly enrolled certificatepkistatusPKIStatus to be included in server response. Possible values: 0..6failureA single failure info bit number to include in server response, 0..26failurebitsNumber representing failure bits to include in server response, 0..2^27 - 1statusstringStatus string to be included in server responsesend_errorForce server to reply with error messagesend_unprotectedSend response messages without CMP-level protectionsend_unprot_errIn case of negative responses, server shall send unprotected error messages,certificate responses (ip/cp/kup), and revocation responses (rp).WARNING: This setting leads to behavior violating RFC 4210accept_unprotectedAccept missing or invalid protection of requestsaccept_unprot_errAccept unprotected error messages from clientaccept_raverifiedAccept RAVERIFIED as proof-of-possession (POPO)Validation options: adds policy to the acceptable policy setpurposecertificate chain purposeverify_nameverification policy nameverify_depthchain depth limitauth_levelchain authentication security levelattimeverification epoch timeverify_hostnameexpected peer hostnameverify_emailexpected peer emailverify_ipexpected peer IP addressignore_criticalpermit unhandled critical extensionsissuer_checkscrl_checkcheck leaf certificate revocationcrl_check_allcheck full chain revocationpolicy_checkperform rfc5280 policy checksexplicit_policyset policy variable require-explicit-policyinhibit_anyset policy variable inhibit-any-policyinhibit_mapset policy variable inhibit-policy-mappingx509_strictdisable certificate compatibility work-aroundsextended_crlenable extended CRL featuresuse_deltasuse delta CRLspolicy_printprint policy processing diagnosticscheck_ss_sigcheck root CA self-signaturestrusted_firstsearch trust store first (default)suiteB_128_onlySuite B 128-bit-only modesuiteB_128Suite B 128-bit mode allowing 192-bit algorithmssuiteB_192Suite B 192-bit-only modepartial_chainaccept chains anchored by intermediate trust-store CAsno_alt_chainsno_check_timeignore certificate validity timeallow_proxy_certsallow the use of proxy certificatesError allocating CMS_contentinfo Bad input format for %s Error reading %s Content Info rbCAdESCMSInvalid key (supplied twice) %s Invalid key %s Invalid id (supplied twice) %s Invalid id %s Invalid OID (supplied twice) %s Invalid OID %s Illegal -inkey without -signer recipient certificate fileNo recipient specified recipient options bufferIllegal multiple -recip_kdf for one -recip Illegal multiple -recip_ukm for one -recip Invalid hex value after -recip_ukm No key specified key param bufferapps/cms.cNo Signed Receipts Recipients Signed receipts only allowed with -sign Multiple signers or keys not allowed Incompatible options: CAdES requires signed attributes Incompatible options: CAdES validation requires certs and signed attributes validations No signer certificate specified No recipient certificate or key specified No recipient(s) certificate(s) specified No operation option (-encrypt|-decrypt|-sign|-verify|...) specified. Warning: -nodetach option is ignored for non-signing operation Warning: -contfile option is ignored for the given operation Warning: recipient certificate file parameters ignored for operation other than -encrypt Warning: -recip_kdf and -recip_ukm parameters ignored for operation other than -encrypt No secret key id certificate fileoriginator certificate filereceipt signer certificate fileCannot use -digest for non-signing operation Cannot use -digest when -in, -nodetach or streaming is used Invalid hex value after -digest SMIMECan't read content file %s Error writing certs to %s Can't open receipt file %s receiptError setting CMS key parameter "%s" Unknown KDF %s Cannot use originator for encryption CMS SignedData Creation Error Signed Receipt Request Creation Error signer certificateError adding SignerInfo with key from %s Error adding CMS ReceiptRequest Error finalizing CMS structure Error creating CMS structure Error decrypting CMS using secret key Error decrypting CMS using private key Error decrypting CMS using password Error decrypting CMS structure Verification successful Verification failure %s Verification successful %s Verification failure Error writing signers to %s Signer %d: No Receipt Request Receipt Request Parse Error Signed Content ID: Receipts From List: : First Tier : All Unknown (%d) Receipts To: To: %s%sFrom: %s%sSubject: %s%sBad output format for CMS file Error writing CMS output Usage: %s [options] [cert...] Input fileOutput fileLoad a configuration file (this may load modules)Operation options: Encrypt messageDecrypt encrypted messageSign messageVerify signed messageresignResign a signed messagesign_receiptGenerate a signed receipt for a messageverify_receiptVerify receipts; exit if receipt signatures do not verifySign a pre-computed digest in hex notationdigest_createCreate a CMS "DigestedData" objectdigest_verifyVerify a CMS "DigestedData" object and output itcompressCreate a CMS "CompressedData" objectuncompressUncompress a CMS "CompressedData" objectEncryptedData_encryptCreate CMS "EncryptedData" object using symmetric keyEncryptedData_decryptDecrypt CMS "EncryptedData" object using symmetric keydata_createCreate a CMS "Data" objectdata_outCopy CMS "Data" object to outputcmsoutOutput CMS structureFile format options: Input format SMIME (default), PEM or DERoutformOutput format SMIME (default), PEM or DERrctformReceipt file formatstreamEnable CMS streamingindefSame as -streamnoindefDisable CMS streamingbinaryTreat input as binary: do not translate to canonical formcrlfeolUse CRLF as EOL termination instead of LF onlyasciicrlfPerform CRLF canonicalisation when signingKeys and passwords options: pwri_passwordSpecific password for recipientsecretkeyUse specified hex-encoded key to decrypt/encrypt recipients or contentsecretkeyidIdentity of the -secretkey for CMS "KEKRecipientInfo" objectinkeyInput private key (if not signer or recipient)Input file pass phrase sourcekeyoptSet public key parameters as n:v pairsInput private key format (ENGINE, other values ignored)Use engine e, possibly a hardware deviceEncryption and decryption options: originatorOriginator certificate filerecipRecipient cert filecert...Recipient certs (optional; used only when encrypting)The encryption algorithm to use (any supported cipher)kekcipherThe key encryption algorithm to usewrapKey wrap algorithm to use when encrypting with key agreement or key encapsulationaes128-wrapUse AES128 to wrap keyaes192-wrapUse AES192 to wrap keyaes256-wrapUse AES256 to wrap keydes3-wrapUse 3DES-EDE to wrap keydebug_decryptDisable MMA protection, return error if no recipient found (see doc)recip_kdfSet KEMRecipientInfo KDF for current recipientrecip_ukmKEMRecipientInfo user keying material for current recipient, in hex notationDigest algorithm to useSigner certificate input filecertfileExtra signer and intermediate CA certificates to include when signingor to use as preferred signer certs and for chain building when verifyingcadesInclude signingCertificate attribute (CAdES-BES)nodetachUse opaque signingnocertsDon't include signer's certificate when signingnoattrDon't include any signed attributesnosmimecapOmit the SMIMECapabilities attributeno_signing_timeOmit the signing time attributereceipt_request_allWhen signing, create a receipt request for all recipientsreceipt_request_firstWhen signing, create a receipt request for first recipientreceipt_request_fromCreate signed receipt request with specified email addressreceipt_request_toCreate signed receipt targeted to specified addressVerification options: Signer certificate(s) output filecontentSupply or override content for detached signatureno_content_verifyDo not verify signed content signaturesno_attr_verifyDo not verify signed attribute signaturesnosigsDon't verify message signaturenoverifyDon't verify signers certificatenointernDon't search certificates in message for signerCheck signingCertificate (CAdES-BES)verify_retcodeExit non-zero on verification failureCAfileTrusted certificates fileCApathTrusted certificates directoryCAstoreTrusted certificates store URIno-CAfileDo not load the default certificates fileno-CApathDo not load certificates from the default certificates directoryno-CAstoreDo not load certificates from the default certificates storekeyidUse subject key identifierecontent_typeOID for external contentInclude or delete text MIME headerscertsoutCertificate output fileTo addressFrom addressSubjectPrinting options: For the -cmsout operation do not output the parsed CMS structureFor the -cmsout operation print out all fields of the CMS structurenameoptFor the -print option specifies various strings printing optionsreceipt_request_printPrint CMS Receipt Request%s = \\n\r\b\t" "apps/configutl.cError on line %ld of configuration file # This configuration file was linearized and expanded from %s [%s] Config file to deal with (the default one if omitted)Output to filename rather than stdoutnoheaderDon't print the information about original configCRLError initialising X509 store Error getting CRL issuer certificate Error getting CRL issuer public key verify OK Missing CRL signing key other CRLCRL signing keyError creating delta CRL issuer=crlNumber=0xissuer name hash=%08lx issuer name old hash=lastUpdate=nextUpdate=NONE%s Fingerprint=%02X%cunable to write CRL Verify CRL signatureInput options: Input file - default stdinCRL input format (DER or PEM); has no effectCRL signing Private key to usePrivate key file format (DER/PEM/P12); has no effectoutput file - default stdoutOutput format - default PEMPrint out a text format versionPrint hash valuePrint old-style (MD5) hash valueCertificate subject/issuer name printing optionsAny supported digestCRL options: Print issuer DNSet lastUpdate fieldSet nextUpdate fieldNo CRL outputfingerprintPrint the crl fingerprintPrint CRL numberbadsigCorrupt last byte of loaded CRL signature (for test)gendeltaOther CRL to compare/diff to the Input oneVerify CRL using certificates in dirVerify CRL using certificates in file nameVerify CRL using certificates in store URIunable to load CRL error opening the file, %s error reading the file, %s error loading certificates unable to write pkcs7 object Input format - DER or PEMnocrlNo crl to load, just certs from '-certfile'File of chain of certs to a trusted CA; can be repeatedOutput format - DER or PEMrsaRSA-%-25s *%s apps/dgst.c%02x(%s)= %s(%s)= Read error in %s Verified OK Error verifying data Error getting maximum length of signed data Signature bufferError signing data key must be set for one-shot algorithms Digest bufferError Digesting Data etaonrishdlcupfmSHA256I/O bufferSupported digests: %s: Can only sign or verify one file. No signature to verify: use the -signature option MAC and signing key cannot both be specified MAC parameter error "%s" Error getting context Error setting context Signature parameter error "%s" Error setting digest Error opening signature file %s signature bufferError reading signature file %s Length can only be specified for XOF Signing key cannot be specified for XOF Usage: %s [options] [file...] listList digestsengine_implAlso use engine given by -engine for digest operationsPrint the digest with separating colonsPrint the digest in coreutils formatKey file format (ENGINE, other values ignored)Print as hex dumpPrint in binary formxoflenOutput length for XOF algorithms. To obtain the maximum security strength set this to 32 (or greater) for SHAKE128, and 64 (or greater) for SHAKE256Print debug infoSign digest using private keyVerify a signature using public keyprverifyVerify a signature using private keyFile with signature to verifyhmacCreate hashed MAC with keyCreate MAC (not necessarily HMAC)macoptMAC algorithm parameters in n:v form or keyfips-fingerprintCompute HMAC with the key used in OpenSSL-FIPS fingerprintFiles to digest (optional; default is stdin)Error, failed to set DH parameters DHXDSAsafe Error, generator may not be chosen for DSA parameters Warning, input file %s ignored Error, %s param generation context allocation failed Generating %s parameters, %d bit long %sprime Error, unable to initialise %s parameters Error, unable to set DSA prime length Error, unable to set DH prime length Error, unable to set generator Error, unable to load parameters Error, unable to load DSA parameters Error, unable to load DH parameters Error, failed to check DH parameters Error, invalid parameters generated DH parameters appear to be ok. Error, unable to write DH parameters Usage: %s [options] [numbits] Check the DH parametersdsaparamRead or generate DSA parameters, convert to DHInput format, DER or PEMOutput format, DER or PEMPrint a text form of the DH parametersDon't output any DH parametersGenerate parameters using 2 as the generator valueGenerate parameters using 3 as the generator valueGenerate parameters using 5 as the generator valueVerbose outputTerse outputnumbitsNumber of bits if generating parameters (optional)MSBLOBPVKtype-specificSubjectPublicKeyInfoError getting passwords unable to load Key Not a DSA key pubPublic Key=writing DSA key PVK form impossible with public key input bad output format specified for outfile %s format not supported encrypt-levelinvalid PVK encryption level unable to write key apps/dsa.cread DSA key Any supported cipherpvk-strongEnable 'Strong' PVK encoding level (default)pvk-weakEnable 'Weak' PVK encoding levelpvk-noneDon't enforce PVK encodingInput keyInput format (DER/PEM/PVK); has no effectpubinExpect a public key in input fileOutput format, DER PEM PVKDon't print key outPrint the key in textPrint the DSA public valuepuboutOutput public key, not privatepassoutOutput file pass phrase sourceError, DSA parameter generation context allocation failed Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %d! Larger key size may behave not as expected. Generating DSA parameters, %d bit long prime This could take some time Error, DSA key generation paramgen init failed Error, DSA key generation setting bit length failed Error, DSA key generation setting subprime bit length failed Error, unable to write DSA parameters Error, DSA key generation context allocation failed Error, unable to initialise for key generation Usage: %s [options] [numbits] [numqbits] Print as textNo outputgenkeyGenerate a DSA keyNumber of bits if generating parameters or key (optional)numqbitsNumber of bits in the subprime parameter q if generating parameters or key (optional)point-formatunable to set point conversion format encodingunable to set asn1 encoding format include-publicunable to disable public key encoding unable to enable public key encoding unable to print EC key unable to check EC key EC Key Invalid! EC Key valid. unable to write EC key apps/ec.cInput format (DER/PEM/P12/ENGINE)check key consistencyparam_encSpecifies the way the ec parameters are encodedconv_formSpecifies the point conversion form Print the keyparam_outPrint the elliptic curve parametersno_publicexclude public key from private keynamed_curveexplicituncompressedcompressedhybridCURVE DESCRIPTION NOT AVAILABLEprime192v1prime256v1list curvesapps/ecparam.c %-10s: secp192r1using curve name prime192v1 instead of secp192r1 secp256r1using curve name prime256v1 instead of secp256r1 groupSM2sm2unable to generate key ECEC parametersSM2 parametersUnable to load parameters from %s seedunable to clear seed unable to print params checking elliptic curve parameters: namedgroup-checkunable to set check_type unable to write elliptic curve parameters list_curvesPrints a list of all curve 'short names'Generate ec keyInput file - default stdinInput format - default PEM (DER or PEM)Output file - default stdoutPrint the ec parameters in text formDo not print the ec parameterParameter options: Validate the ec parameterscheck_namedCheck that named EC curve parameters have not been modifiedno_seedIf 'explicit' parameters are chosen do not use the seedUse the ec parameters with specified 'short name'hex string is too long, ignoring excess hex string is too short, padding with zero bytes to length non-hex digit base64encSupported ciphers: %s Can't read key from %s %s: zero length password %s: out of memory bufsize=%d strbufevp bufferUnstreamable cipher mode decryptionenter %s %s password:bad password read invalid hex salt value RAND_bytes failed error writing output file error reading input file bad magic number PKCS5_PBKDF2_HMAC failed *** WARNING : deprecated key derivation used. Using -iter or -pbkdf2 would be better. EVP_BytesToKey failed warning: iv not used by this cipher invalid hex iv value iv undefined invalid hex key value Either a raw key or the 'skeyopt' args must be used. Error setting cipher %s Error creating opaque key object for skeymgmt %s Error setting an opaque key for cipher %s salt=%02Xkey=iv =bad encrypt bad decrypt bytes read : %8ju bytes written: %8ju apps/enc.cList ciphersciphersAlias for -listEncryptDecryptPrint the iv/keyPPrint the iv/key and exitPassphrasekfileRead passphrase from filepassPassphrase sourceBase64 encode/decode, depending on encryption flagSame as option -aUsed with -[base64|a] to specify base64 buffer as a single linenopadDisable standard block paddingsaltUse salt in the KDF (default)nosaltDo not use salt in the KDFbufsizeBuffer sizeRaw key, in hexSalt, in hexivIV in hexUse specified digest to create a key from the passphraseSpecify the iteration count and force the use of PBKDF2Default: 10000pbkdf2Use password-based key derivation function 2 (PBKDF2)Use -iter to change the iteration count from 10000Don't encryptsaltlenSpecify the PBKDF2 salt length (in bytes)Default: 16skeyoptKey options as opt:value for opaque symmetric key handlingskeymgmtSymmetric key management name for opaque symmetric key handlingengine bufferapps/engine.cSTORE(%s)[Error]: internal stack error [Success]: %s [Error]: command name too long [Failure]: %s %s: Cannot mix flags and engine names. Loaded: (%s) %s RAND [%s] [ available ] [ unavailable ] %s%s(input flags): |<0x%04X> NO_INPUTSTRINGNUMERIC[Internal] description bufferUsage: %s [options] engine... Check that specified engine is availablepreRun command against the ENGINE before loading itpostRun command against the ENGINE after loading itList 'control commands' For each specified enginevvAlso display each command's descriptionvvvAlso add the input flags for each commandvvvvAlso show internal input flagsList the capabilities of specified enginettDisplay error trace for unavailable enginesCommands are like "SO_PATH:/lib/libdriver.so"ID of engine(s) to load%lxUsage: %s [options] errnum... errnumError number(s) to decodest-phasest-descst-typeStart%s : (%s) : PassFailCorrupt%s %s = %s apps/fipsinstall.c[%s] activate = 1 install-versionconditional-errorssecurity-checkshmac-key-checkkmac-key-checktls1-prf-ems-checkno-short-macdrbg-no-trunc-mdsignature-digest-checkhkdf-digest-checktls13-kdf-digest-checktls1-prf-digest-checksshkdf-digest-checksskdf-digest-checkx963kdf-digest-checkdsa-sign-disabledtdes-encrypt-disabledrsa-pkcs15-pad-disabledrsa-pss-saltlen-checkrsa-sign-x931-pad-disabledhkdf-key-checkkbkdf-key-checktls13-kdf-key-checktls1-prf-key-checksshkdf-key-checksskdf-key-checkx963kdf-key-checkx942kdf-key-checkpbkdf2-lower-bound-checkecdh-cofactor-checkmodule-macinstall-macINSTALL_SELF_TEST_KATS_RUNinstall-statusfipsHMACfips_sectVERIFYINSTALLno_conditional_errorsCannot specify -%s after -pedantic no_security_checksno_pbkdf2_lower_bound_checkhexkey:digest:self_test_oninstallMissing -in option for -verify not availableFIPS provider is %s digest:SHA256hexkey:f4556650ac31d35461610bac4ed81b1a181b2d8a43ea2854cbae22ca74560813Failed to open module file Unable to get MAC of type %s Unable to create MAC CTX for module check MAC parameter error Unable to create MAC CTX for install indicator Unable to create memory BIO version not found Module integrity MAC not found Module integrity mismatch install status not found Install indicator MAC not found Install indicator status mismatch VERIFY PASSED openssl_conf = openssl_init [openssl_init] providers = provider_section [provider_section] %s = %s Failed to load FIPS module buildinfoFailed to query FIPS module parameters name: %-10s %s version:build:3.0.Failed to open file INSTALL PASSED %s FAILED pedanticSet options for strict FIPS complianceVerify a config file instead of generating onemoduleFile name of the provider moduleprovider_nameFIPS provider namesection_nameFIPS Provider config section name (optional)Disable the ability of the fips module to enter an error state if any conditional self tests failDisable the run-time FIPS security checks in the moduleself_test_onloadForces self tests to always run on module loadForces self tests to run once on module installationems_checkEnable the run-time FIPS check for EMS during TLS1_PRFno_short_macDisallow short MAC outputno_drbg_truncated_digestsDisallow truncated digests with Hash and HMAC DRBGssignature_digest_checkEnable checking for approved digests for signatureshmac_key_checkEnable key check for HMACkmac_key_checkEnable key check for KMAChkdf_digest_checkEnable digest check for HKDFtls13_kdf_digest_checkEnable digest check for TLS13-KDFtls1_prf_digest_checkEnable digest check for TLS1-PRFsshkdf_digest_checkEnable digest check for SSHKDFsskdf_digest_checkEnable digest check for SSKDFx963kdf_digest_checkEnable digest check for X963KDFdsa_sign_disabledDisallow DSA signingtdes_encrypt_disabledDisallow Triple-DES encryptionrsa_pkcs15_padding_disabledDisallow PKCS#1 version 1.5 padding for RSA encryptionrsa_pss_saltlen_checkEnable salt length check for RSA-PSS signature operationsrsa_sign_x931_disabledDisallow X931 Padding for RSA signinghkdf_key_checkEnable key check for HKDFkbkdf_key_checkEnable key check for KBKDFtls13_kdf_key_checkEnable key check for TLS13-KDFtls1_prf_key_checkEnable key check for TLS1-PRFsshkdf_key_checkEnable key check for SSHKDFsskdf_key_checkEnable key check for SSKDFx963kdf_key_checkEnable key check for X963KDFx942kdf_key_checkEnable key check for X942KDFDisable lower bound check for PBKDF2ecdh_cofactor_checkEnable Cofactor check for ECDHInput config file, used when verifyingOutput config file, used when generatingmac_nameMAC nameMAC algorithm parameters in n:v form.See 'PARAMETER NAMES' in the EVP_MAC_ docsDisable logging of self test eventscorrupt_descCorrupt a self test by descriptioncorrupt_typeCorrupt a self test by typeThe parent config to verifyNo messages, just exit statusparams fileunable to set up for key generation unable to output generated key apps/gendsa.cUsage: %s [options] dsaparam-file Output the key to the specified fileEncrypt the output with any supported cipherdsaparam-fileFile containing DSA parametersAlgorithm already set! Error initializing %s context The possible -pkeyopt arguments are: %s%s:%s Can't open parameter file %s Error reading parameter file %s %s: Error setting %s parameter: Cannot use cipher with -genparam option Bad format specified for key Error writing key(s) Error printing key Error writing to outpubkey: '%s'. Error: %s Error writing to outfile: '%s'. Error: %s apps/genpkey.cuintfloatstringparamfileParameters fileThe public key algorithmOutput status while generating keysDo not output status while generating keyspkeyoptSet the public key algorithm option as opt:valueOutput (private key) fileoutpubkeyOutput public key fileoutput format (DER or PEM)genparamGenerate parameters, not keyPrint the private key in textCipher to use to encrypt the keyOrder of options may be important! See the documentation. apps/genrsa.cWarning: It is not recommended to use more than %d bit for RSA keys. Your key size is %d! Larger key size may behave not as expected. Error setting RSA length Error allocating RSA public exponent Error setting RSA public exponent Error setting number of primes Error cannot access RSA e e is %s (0x%s) Usage: %s [options] numbits (deprecated) Use 3 for the E valueF4Use the Fermat number F4 (0x10001) for the E valuef4Output the key to specified fileprimesSpecify number of primestraditionalUse traditional format for private keysSize of key in bitsUndefined%s: Only one item allowed %s: No items chosen configdirDefault configuration file directoryenginesdirDefault engine module directorymodulesdirDefault module directory (other than engine modules)dsoextConfigured extension for modulesdirnamesepDirectory-filename separatorlistsepList separator characterseedsSeed sourcescpusettingsCPU settings infowindowscontextWindows install contextapps/kdf.calgorithm name%s:%sInvalid KDF name %s KDF parameter error Invalid derived key length. out bufferEVP_KDF_derive failed %s Usage: %s [options] kdf_name kdfoptKDF algorithm control parameters in n:v formCipherDigestMACSee 'Supported Controls' in the EVP_KDF_ docs keylenThe size of the output derived keyOutput in binary format (default is hexadecimal)kdf_nameName of the KDF algorithm %s @ %s state = %s stateERROR: Memory allocation %sLegacy: %sProvided: description: %s retrievable algorithm parametersretrievable operation parameterssettable operation parametersProvided KDFs and PDFs: Provided MACs: %-*sProvided ENCODERs: @ %s (%s) Provided DECODERs: Name: Type: Provider Algorithm IDs: settable key generation parameters - TLS-SIGALGtls-sigalg-iana-nameProvided STORE LOADERs: %s %s => %s ExternalBuiltin(none)Invalid command '%s'; type "help" for a list. - - %s %c Digests: Symmetric Ciphers: Provided Asymmetric Encryption: Provided Key Exchange: Provided Signatures: Provided Key encapsulation: Provided Key managers: primaryprivateProvided RNGs and seed sources: apps/list.cERROR: could not list all provider signature algorithms No TLS sig algs registered by currently active providersERROR: setting TLS protocol version ERROR: getting implemented TLS group list %s%cProvided: Key Managers: Legacy: Name: %s Alias for: %s Type: %s Algorithm OID: %s PEM string: %s Key Exchange: Signatures: Key encapsulation: Providers: WARNING: Unable to query provider parameters for %s name: %s version: %s status: %sactive build info: %s gettable provider parametersEngines: Disabled algorithms: MD2 RC5 SCTP SSL3 ZLIB BROTLI ZSTD # None-OID object: %s, %s %s = %s, %s uninitialisedreadyList in one columnVerbose listingselectSelect a single algorithmList of standard commandsstandard-commandsall-algorithmsList of all algorithmsdigest-commandsList of message digest commands (deprecated)digest-algorithmsList of message digest algorithmskdf-algorithmsList of key derivation and pseudo random function algorithmsrandom-instancesList the primary, public and private random number generator detailsrandom-generatorsList of random number generatorsmac-algorithmsList of message authentication code algorithmscipher-commandsList of cipher commands (deprecated)List of symmetric cipher algorithmsencodersList of encoding methodsdecodersList of decoding methodskey-managersList of key managersskey-managersList of symmetric key managerskey-exchange-algorithmsList of key exchange algorithmskem-algorithmsList of key encapsulation mechanism algorithmsList of signature algorithmstls-signature-algorithmsList of TLS signature algorithmsasymcipher-algorithmsList of asymmetric cipher algorithmspublic-key-algorithmsList of public key algorithmspublic-key-methodsList of public key methodsstore-loadersList of store loadersList implemented TLS key exchange 'groups'all-tls-groupsList implemented TLS key exchange 'groups' and all aliasesWhen listing 'groups', list those compatible with TLS1.2When listing 'groups', list those compatible with TLS1.3List of provider informationList of loaded enginesdisabledList of disabled featuresList options for specified commandobjectsList built in objects (OID<->name mappings)apps/mac.cInvalid MAC name %s EVP_MAC_Init failed Read Error in '%s' EVP_MAC_update failed EVP_MAC_final failed output len is too large Usage: %s [options] mac_name MAC algorithm parameters in n:v formInput file to MAC (default is stdin)MAC algorithm%s: Error reading certs file %s %s: Error reading sequence file %s toseqOutput NS Sequence fileapps/ocsp.c%s Error parsing -url argument issuer certificateNo issuer certificate specified Error Creating OCSP request Error converting serial number %s Missing = in header key=value %s: Digest must be before -cert or -serial Error reading OCSP request responder certificateError loading responder certificate responder other certificatesresponder private keyResponder mode requires certificate, key, and CA. waiting for OCSP client connections...index file changed, reloadingerror reloading updated index: %sapplication/ocsp-responseNeed an OCSP request for this operation! Error loading signer certificate signer private keysigner certificatesError signing OCSP request assertion failed: bnassertion failed: itmpError creating SSL context. application/ocsp-requestError querying OCSP responder Error reading OCSP response Responder Error: %s (%d) validator certificatesError parsing response WARNING: no nonce in response Nonce Verify error Response Verify Failure Response verify OK %s: ERROR: No Status found. WARNING: Status times invalid. This Update: Next Update: Reason: %s Revocation Time: ignore_errIgnore error on OCSP request or response and continue runningResponder options: Connection timeout (in seconds) to the OCSP responderresp_no_certsDon't include any certificates in responsemultirun multiple responder processesno_certsDon't include any certificates in signed requestCorrupt last byte of loaded OCSP response signature (for test)nminNumber of minutes before next updatenrequestNumber of requests to accept (default unlimited)File with the DER-encoded requestCertificate to sign OCSP request withsign_otherAdditional certificates to include in signed requestindexCertificate status index filendaysNumber of days before next updatersignerResponder certificate to sign responses withrkeyResponder key to sign responses withResponder key pass phrase sourcerotherOther certificates to include in responsermdDigest Algorithm to use in signature of OCSP responsersigoptOCSP response signature parameter in n:v formheaderkey=value header to addrcidUse specified algorithm for cert id in responseAny supported digest algorithm (sha1,sha256, ... )Client options: urlResponder URLTCP/IP hostname:port to connect toPort to run responder onPath to use in OCSP request[http[s]://]host[:port][/path] of HTTP(S) proxy to use; path is ignoredOutput filenameDon't verify response at allnonceAdd OCSP nonce to requestno_nonceDon't add OCSP nonce to requestno_signature_verifyDon't check signature on responseresp_key_idIdentify response by signing certificate key IDno_cert_verifyDon't check signing certificatePrint text form of request and responsereq_textPrint text form of requestresp_textPrint text form of responseno_chainDon't chain verify responseno_cert_checksDon't do additional checks on signing certificateno_explicitDo not explicitly check the chain, just verify the roottrust_otherDon't verify additional certificatesno_internDon't search certificates contained in response for signerrespinFile with the DER-encoded responseVAfileValidator certificates fileverify_otherAdditional certificates to search for signerCertificate to check; may be given multiple timesSerial number to check; may be given multiple timesvalidity_periodMaximum validity discrepancy in secondssignkeyPrivate key to sign OCSP request withOutput file for the DER-encoded requestrespoutOutput file for the DER-encoded responseIssuer certificatestatus_ageMaximum status age in secondsThe command %s was deprecated in version %s.The command %s is deprecated. Use '%s' instead.apps_startupprog_initOPENSSL_SEC_MEMFATAL: could not convert OPENSSL_SEC_MEM (%s) to number OPENSSL_SEC_MEM_MINSIZEFATAL: could not convert OPENSSL_SEC_MEM_MINSIZE (%s) to number FATAL: could not initialize secure memory OPENSSL_TEST_LIBCTXFATAL: Startup failure (dev note: %s()) for %s %s: could not get default config file -help--help-h--h-version--version-v--vapps/openssl.cUsage: %s %s: Standard commands Message Digest commands (see the `dgst' command for more details) Cipher commands (see the `enc' command for more details) Usage: help [options] [command] commandName of command to display help (optional)apps/passwd.capr1salt bufferWarning: truncating password to %u characters rounds=%u%s %s %s: Can't combine -in and -stdin Password: Usage: %s [options] [password] Read passwords from fileNever verify when reading password from terminalRead passwords from stdinNo warningstableFormat output as tablereverseSwitch table columnsCryptographic options: Use provided saltSHA512-based password algorithmSHA256-based password algorithmMD5-based password algorithm, Apache variantaixmd5AIX MD5-based password algorithmPassword text to digest (optional), , %s, %s, Iteration %ld, PRF %s, Salt length: %d, Cost(N): %ld, Block size(r): %ld, Parallelism(p): %ld, Iteration %ldapps/pkcs12.c%.*s %02X %s (%s) %s: %s: Key bag Bag AttributesKey AttributesShrouded Keybag: Certificate bag Secret bag Bag Type: Bag Value: Safe Contents bag Warning unsupported bag type: PKCS7 Data PKCS7 Encrypted data: sha1private key from -inkey fileprivate key from -in fileWarning: -%s option ignored with -export nomacverclcertscacertsWarning: output encryption option -%s ignored with -export Warning: -%s option ignored without -export passcertscanameCSPLMKkeyexkeysigkeypbecertpbe and -descertmacalgiter and -noiternomaciternomacmacsaltlenlegacyError getting certificate file password Option -twopass cannot be used with -passout or -password Option -twopass cannot be used with -passin or -password Can't read Password Nothing to export due to -noout or -nocerts and -nokeys Warning: -chain option ignored with -nocerts certificates from -in fileNo certificate in -in file %s No cert in -in file '%s' matches private key No end entity certificate to check with -chain Error getting chain: %s extra certificates from -certfileEnter Export Password:Error creating PKCS12 structure for %s Error creating PBMAC1 Error creating PKCS12 MAC; no PKCS12KDF support? Use -nomac or -pbmac1_pbkdf2 if PKCS12KDF support not available Enter Import Password:MAC: , Unsupported KDF or params for PBMAC1 using PBKDF2, Iteration %ld Key length: %ld, Salt length: %d PBKDF2 PRF: %s , Iteration %ld MAC length: %ld, salt length: %ld Warning: MAC is absent! PKCS12KDFError verifying PKCS12 MAC; no PKCS12KDF support. Use -nomacver if MAC verification is not required. Mac verify error: invalid password? Warning: using broken algorithm Error outputting keys and certificates Enter MAC Password:Set PKCS#12 import/export password sourcetwopassSeparate MAC, encryption passwordsnokeysDon't output private keysDon't output certificatesDon't output anything, just verify PKCS#12 inputUse legacy encryption: 3DES_CBC for keys, RC2_CBC for certsPKCS#12 import (parsing PKCS#12) options: Print info about PKCS#12 structureDon't verify integrity MACOnly output client certificatesOnly output CA certificatesAny supported cipher for output encryptionnoencDon't encrypt private keysnodesDon't encrypt private keys; deprecatedPKCS#12 output (export) options: exportCreate PKCS12 filePrivate key, else read from -in input fileExtra certificates for PKCS12 outputCertificate file pass phrase sourceBuild and add certificate chain for EE cert,which is the 1st cert from -in matching the private key (if given)Untrusted certificates for chain buildingPEM-format file of CA'sPEM-format directory of CA'sURI to store of CA'sUse name as friendly nameUse name as CA friendly name (can be repeated)Microsoft CSP nameAdd local machine keyset attribute to private keySet key type to MS key exchangeSet key type to MS key signaturePrivate key PBE algorithm (default AES-256 CBC)certpbeCertificate PBE algorithm (default PBES2 with PBKDF2 and AES-256 CBC)descertEncrypt output with 3DES (default PBES2 with PBKDF2 and AES-256 CBC)Digest algorithm to use in MAC (default SHA256)pbmac1_pbkdf2Use PBMAC1 with PBKDF2 instead of MACpbmac1_pbkdf2_mdDigest to use for PBMAC1 KDF (default SHA256)Specify the iteration count for encryption and MACnoiterDon't use encryption iterationDon't use MAC iteration)maciterUnused, kept for backwards compatibilitySpecify the salt len for MACDon't generate MACjdktrustMark certificate in PKCS#12 store as trusted for JDK compatibilityunable to allocate PKCS7 object unable to load PKCS7 object Don't output encoded dataPrint full details of certificatesPrint out all fields of the PKCS7 structureprint_certsPrint_certs print any certs or crl in the inputWhen used with -print_certs, it produces a cleaner output%s: Unknown PBE algorithm %s %s: Unknown PRF algorithm %s Error converting key Error setting PBE algorithm Enter Encryption Password:Error encrypting key Error reading key Enter Password:Error decrypting key apps/pkcs8.cUse PKCS#5 v1.5 and cipherv2Use PKCS#5 v2.0 and cipherv2prfSet the PRF algorithm to use with PKCS#5 v2.0Input format (DER or PEM)nocryptUse or expect unencrypted private keyOutput format (DER or PEM)topk8Output PKCS8 fileuse traditional format private keySpecify the iteration countUse 1 as iteration countSpecify the salt length (in bytes)Default: 8 (For PBE1) or 16 (for PBE2)Scrypt options: scryptUse scrypt algorithmscrypt_NSet scrypt N parameterscrypt_rSet scrypt r parameterscrypt_pSet scrypt p parameterWarning: The -text option is ignored with -text_pub Warning: -traditional is ignored with no private key output Warning: The -passout option is ignored without a cipher option Error: Cipher options are supported only for PEM output Public KeyKey is valid Key is invalid Error: Text output cannot be combined with DER output apps/pkey.cCheck key consistencypubcheckCheck public key consistencyKey input format (ENGINE, other values ignored)Key input pass phrase sourceRead only public components from key inputOutput file for encoded and/or text outputOutput encoding format (DER or PEM)Any supported cipher to be used for encryptionOutput PEM file pass phrase sourceUse traditional format for private key PEM outputRestrict encoded output to public componentsDo not output the key in encoded formOutput key components in plaintexttext_pubOutput only public key components in text formec_conv_formSpecifies the EC point conversion form in the encodingec_param_encSpecifies the way the EC parameters are encodedError reading parameters Parameters are valid Parameters are invalid Check key param consistencyPrint parameters as textDon't output encoded parameters(unknown key type)%s: no KDF length given (-kdflen parameter). %s: no private key given (-inkey parameter). %s: -peerkey option not allowed without -derive. %s: missing -peerkey option for -derive operation. A private key is needed for this operation %s: Error loading key apps/pkeyutl.c%s: -verifyrecover can be used only with RSA %s: -rev cannot be used with raw input %s: -digest (prehash) is not supported with %s %s: -digest and -rawin can only be used with -sign or -verify Error: out of memory The given KDF "%s" is unknown. %s: Error initializing context peer keyError reading peer key %s Type of peer public key: %s does not match type of private key: %s %s: Error setting up peer key %s: Can't set parameter "%s": Enter %s: user abort entry failed failed to get '%s' %s: Signature file specified for non verify %s: No signature file specified for verify %s: Decapsulation produces only a shared secret and no output. The '-out' option is not applicable. KEM-based shared-secret derivation requires the '-secret ' option Can't open signature file %s Error reading signature data Error reading input Data Error: The non-raw input data length %d is too long - max supported hashed size is %d Error: unable to determine file size for oneshot operation oneshot sign/verify bufferError reading raw input data Error verifying raw input data Signature Verified Successfully Signature Verification Failure buffer outputError signing raw input data secret outputPublic Key operation error Key derivation failed Also use engine given by -engine for crypto operationsSign input data with private keyVerify with public keyEncrypt input data with public keyDecrypt input data with private keyderiveDerive shared secret from own and peer (EC)DH keysdecapDecapsulate shared secretencapEncapsulate shared secretInput key, by default private keyInput key is a public keypeerkeyPeer key file used in key derivationpeerformPeer key format (DER/PEM/P12/ENGINE)certinInput is a cert with a public keyrevReverse the order of the input buffersigfileSignature file (verify operation only)Private key format (ENGINE, other values ignored)File to store secret on encapsulationasn1parseparse the output as ASN.1 data to check its DER encoding and print errorshexdumpHex dump outputverifyrecoverVerify RSA signature, recovering original signature input dataSigning/Derivation/Encapsulation options: rawinIndicate that the signature/verification input data is not yet hashedThe digest algorithm to use for signing/verifying raw input data. Implies -rawinPublic key options as opt:valuepkeyopt_passinPublic key option that is read as a passphrase argument opt:passphrasekdfUse KDF algorithmkdflenKDF algorithm output lengthkemopKEM operation specific to the key algorithmisis notFailed to process value (%s) Error checking prime (%s) %s prime Missing number (s) to check Specify the number of bits. Out of memory. Failed to generate prime. apps/prime.cError opening file %s Value in %s is over the maximum size (%d digits) 1234567890abcdefABCDEFUsage: %s [options] [number...] Size of number in bitsNumber of checksEnables hex format for output from prime generation or input to primality checkingProvide file names containing numbers for primality checkinggenerateGenerate a primesafeWhen used with -generate, generate a safe primeNumber(s) to check for primality if not generatingcmsconfigutlcrl2pkcs7dgstdhparamdsaecparamerrstrfipsinstallgendsagenpkeygenrsanseqocsppasswdpkcs12pkcs8pkeypkeyparampkeyutlrehashrsautls_clients_servers_timesess_idskeyutlsmimespeedstoreutlmd4md5sha224sha512-224sha512-256sha3-224sha3-256sha3-384sha3-512shake128shake256mdc2rmd160blake2b512blake2s256sm3aes-128-cbcaes-128-ecbaes-192-cbcaes-192-ecbaes-256-cbcaes-256-ecbaria-128-cbcaria-128-cfbaria-128-ctraria-128-ecbaria-128-ofbaria-128-cfb1aria-128-cfb8aria-192-cbcaria-192-cfbaria-192-ctraria-192-ecbaria-192-ofbaria-192-cfb1aria-192-cfb8aria-256-cbcaria-256-cfbaria-256-ctraria-256-ecbaria-256-ofbaria-256-cfb1aria-256-cfb8camellia-128-cbccamellia-128-ecbcamellia-192-cbccamellia-192-ecbcamellia-256-cbccamellia-256-ecbdesdes3desxidearc4rc4-40rc2bfcastdes-ecbdes-ededes-ede3des-cbcdes-ede-cbcdes-ede3-cbcdes-cfbdes-ede-cfbdes-ede3-cfbdes-ofbdes-ede-ofbdes-ede3-ofbidea-cbcidea-ecbidea-cfbidea-ofbseed-cbcseed-ecbseed-cfbseed-ofbrc2-cbcrc2-ecbrc2-cfbrc2-ofbrc2-64-cbcrc2-40-cbcbf-cbcbf-ecbbf-cfbbf-ofbcast5-cbccast5-ecbcast5-cfbcast5-ofbcast-cbcsm4-cbcsm4-ecbsm4-cfbsm4-ofbsm4-ctrInvalid size suffix %s %lu bytes with suffix overflows Request exceeds max allowed output buffer for output fileapps/rand.cUsage: %s [options] num[K|M|G|T] Base64 encode outputHex encode outputnumNumber of bytes to generateapps/rehash.chash bucket%s: warning: skipping duplicate %s in %s %s: error: hash table overflow for %s collision bucketSkipping %s, can't write Doing %s Skipping %s, out of memory filename buffer%s%s%s%s: error: skipping %s, cannot open file %s: warning: skipping %s, it does not contain exactly one certificate or CRL %s: error calculating SHA1 hash value link %s -> %s %s%s%08x.%s%d%s: Can't unlink %s, %s %s: Can't symlink %s, %s unlink %s Usage: %s [options] [directory...] compatCreate both new- and old-style hash linksUse old-style hash to generate linksDo not remove existing linksdirectoryOne or more directories to process (optional)crtcerapps/req.c%s [%s]:String too long, must be at most %d bytes long String too short, must be at least %d bytes long %s '%s' too long Missing newline at end of input req_extensionsissuer private key from -CAkey argissuer private key from -CA argCan't find keygen engine %s %s: -days parameter arg must be >= -1 Serial number supplied twice Parse error on -addext: missing '=' Parse error on -addext: missing key Duplicate extension name: %s Internal error handling -addext %s Unknown cipher: %s Warning: Ignoring -days without -x509; not generating a certificate Warning: Ignoring -not_before without -x509; not generating a certificate Warning: Ignoring -not_after without -x509; not generating a certificate Warning: Ignoring -copy_extensions 'none' when -x509 is not given Warning: Will read cert request from stdin since no -in option is given Using additional configuration from -addext options Problems opening '%s' for extra OIDs Error checking %s extension section %s Error checking extensions defined using -addext input_passwordoutput_passwordWarning: Not generating key via given -newkey option since -key is given default_bitsParameter file requested but no path given: %s Cannot open parameter file %s Unable to determine key type Key type does not match parameters Error allocating keygen context Error initializing keygen context RSA-PSSError setting keysize Private key length too short, needs to be at least %d bits, not %ld. Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %ld! Larger key size may behave not as expected. Key parameter error "%s" Writing private key to stdout encrypt_rsa_keyencrypt_key----- Warning: Not placing -key in cert or request since request is used X509 requestWarning: Ignoring -in option since -new or -newkey or -precert is given Warning: Ignoring -CAkey option since no -CA option is given issuer cert from -CA argIssuer CA certificate and key do not match Must provide a signature key using -key or provide -CA / -CAkey promptdistinguished_nameUnable to get '%s' section attributesError: No objects specified in config file You are about to be asked to enter information that will be incorporated into your certificate request. What you are about to enter is what is called a Distinguished Name or a DN. There are quite a few fields but you can leave some blank For some fields there will be a default value, If you enter '.', the field will be left blank. _min_max_default_valueDN defaultDN value Please enter the following 'extra' attributes to be sent with your certificate request Attribute defaultAttribute valueError adding attribute No template, please set one up. Error making certificate request Warning: Not using -key or -newkey for signing since -CA option is given Warning: -not_after option overriding -days option Warning: No -copy_extensions given; ignoring any extensions in the request Error copying extensions from request Error adding x509 extensions from section %s Error adding x509 extensions defined via -addext Error adding poison extension Warning: Ignoring -precert flag since no cert is produced Error adding request extensions from section %s Error adding request extensions defined via -addext Modifying subject of certificate request Old subject=Error modifying subject of certificate request New subject=Certificate request self-signature verify failure Certificate request self-signature verify OK Error getting public key Error printing certificate Error printing certificate request Modulus is unavailable Modulus=Wrong Algorithm typeUnable to write certificate request Unable to write X509 certificate default_keyfileSpecify the cipher for private key encryptionkeygen_engineSpecify engine to be used for key generation operationsX.509 request input file (default stdin)Verify self-signature on the requestNew requestRequest template fileConfig section to use (default "req")Input characters are UTF8 (default ASCII)reqoptVarious request text optionsText form of requestOutput an X.509 certificate structure instead of a cert requestx509v1Request cert generation with X.509 version 1Issuer cert to use for signing a cert, implies -x509CAkeyIssuer private key to use with -CA; default is -CA arg(Required by some CA's)Set or modify subject of request or certPrint the subject of the output request or certNumber of days certificate is valid forset_serialSerial number to usecopy extensions from request when using -x509Cert or request extension section (override value in config file)An alias for -extensionsaddextAdditional cert extension key=value pair (may be given more than once)precertAdd a poison extension to generated cert (implies -new)Keys and Signing options: Key for signing, and to include unless -in givenOutput public keykeyoutFile to write private key toPrivate key and certificate password sourceGenerate new key with [:] or [:] or param:Do not ask anything during request generationDo not output REQnewhdrOutput "NEW" in the header linesRSA moduluspkcs1PrivateKeyInfoOnly private keys can be checked Not an RSA key RSA unable to create PKEY context RSA key ok RSA key not ok writing RSA key apps/rsa.cVerify key consistencyRSAPublicKey_inInput is an RSAPublicKeyOutput format, one of DER PEM PVKOutput a public keyRSAPublicKey_outOutput is an RSAPublicKeyPrint the RSA key modulusPVK options: hold rsa keyoutput rsa keyRSA operation error apps/rsautl.cSign with private keyEncrypt with public keyDecrypt with private keyInput key, by default an RSA private keyInput key is an RSA public pkeyInput is a cert carrying an RSA public keyrawUse no paddingpkcsUse PKCS#1 v1.5 padding (default)x931Use ANSI X9.31 paddingoaepUse PKCS#1 OAEPRun output through asn1parse; useful with -verifySERVERINFO FOR EXTENSION %dProtocols advertised by server: psk_client_cb NULL received PSK identity hint, continuing anyway Received PSK identity hint '%s' created identity '%s' len=%d Could not convert PSK key '%s' to buffer psk buffer of callback is too small (%d) for key (%ld) apps/s_client.ccreated PSK len=%ld Error in PSK client callback Error finding suitable ciphersuite hexdecode--- Reused, --- New, --- Certificate chain %2d s: i: a:PKEY: %s, (%s); sigalg: %s a:PKEY: %s, %d (bit); sigalg: %s v:NotBefore: ; NotAfter: --- Server certificate no peer certificate available Client-to-server raw public key negotiated Server-to-client raw public key negotiated Server raw public key no peer rpk available --- SSL handshake has read %ju bytes and written %ju bytes --- SCTs present (%i) SCT validation status: %s --- %s, Cipher is %s Protocol: %s Server public key is %d bit Compression: %s Expansion: %s Next protocol: (%d) ALPN protocol: No ALPN negotiated SRTP Extension negotiated, profile=%s Early data was not sent Early data was rejected Early data was accepted Verify return code: %ld (%s) Keying material exporter: Label: '%s' Length: %i bytes export key Error Keying material: Error writing session file %s --- Post-Handshake New Session Ticket arrived: Can't use SSL_get_servername OCSP responses: no responses sent number of responses: %dno OCSP response to print ====================================== OCSP response: no OCSP response received OCSP response parse error noreqDONE RECONNECTING RENEGOTIATING ERROR KEYUPDATE ERROR PROCESSING COMMAND. REST OF LINE IGNORED: %s quitreconnectfinkeyuprenegUNRECOGNISED COMMAND (IGNORED): %s Enter text to send to the peer followed by To issue a command insert {cmd} or {cmd:arg} anywhere in the text Entering {{ will send { to the peer The following commands are available {help}: Get this help text {quit}: Close the connection to the peer {reconnect}: Reconnect to the peer {fin}: Send FIN on the stream. No further writing is possible {keyup:req|noreq}: Send a Key Update message Arguments: req = peer update requested (default) noreq = peer update not requested {reneg}: Attempt to renegotiate BAD ARGUMENT (COMMAND IGNORED): %s localhostmail.example.comclient4433cbufsbufmbuf%s: Intermixed protocol flags (unix and internet domains) %s: Intermixed protocol flags (internet and unix domains) Cannot supply multiple protocol flags Cannot supply both a protocol flag and '-no_' Error getting client auth engine Error writing file %s Not a hex number '%s' SRP minimal length for N is %d %s: Max Fragment Len %u is out of permitted values%s: cannot provide both -connect option and target parameter %s: Can't use both -4 and -6 %s: Can't use -servername and -noservername together %s: Can't use -dane_tlsa_domain and -noservername together Cannot supply -nextprotoneg with TLSv1.3 %s: -connect argument or target parameter malformed or ambiguous %s: -proxy requires use of -connect or target parameter %s: -proxy argument malformed or ambiguous %s: -bind argument parameter malformed or ambiguous Can't use unix sockets and datagrams together Error parsing -nextprotoneg argument Error getting private key password Error getting proxy password Error: Must specify proxy_user with proxy_pass client certificate private keyclient certificate chainError adding CRL Unable to create BIO Error using configuration "%s" Error setting verify params %s: Max send fragment size %u is out of permitted range %s: Split send fragment size %u is out of permitted range %s: Max pipelines %u is out of permitted range %s: Max Fragment Length code %u is out of permitted values Error loading store locations Error loading CA names Error setting client auth engine PSK key given, setting client callback Can't open PSK session file %s Can't read PSK session file %s Error setting SRTP profile Error parsing -alpn argument Error setting ALPN Warning: Unable to add custom extension %u, skipping %s: Error enabling DANE TLSA authentication. Error setting client certificate types Error setting server certificate types Can't open session file %s Can't set session Unable to set TLS servername extension. %s: DANE TLSA authentication requires at least one -dane_tlsa_rrdata option. %s: warning: bad TLSA %s field in: %s %s: warning: unusable TLSA rrdata: %s %s: warning: error loading TLSA rrdata: %s %s: Failed to import any TLSA records. %s: DANE TLSA authentication requires the -dane_tlsa_domain option. %s: DTLS does not support the -tfo option %s: QUIC does not support the -tfo option %s: QUIC requires ALPN to be specified (e.g. "h3" for HTTP/3) via the -alpn option Connecting via TFO connect:errno=%d CONNECTED(%08X) getsockname:errno=%d MTU too small. Must be at least %ld Failed to set MTU Failed to set the initial peer address LHLO %s EHLO %s STARTTLSDidn't find STARTTLS in server response, trying anyway... STARTTLS STLS BIO_read failed . CAPABILITY . STARTTLS AUTH TLS %d Failed to initiate requestLOOKUP renego during write Write BLOCK (Async) Write BLOCK ERROR - memory ERROR - unable to connect LOOKUP during accept %s DELAY verify error:%s LOOKUP renego during read Read BLOCK (Async) Read BLOCK shutting down SSL CONNECTION CLOSED server www bufferGET GET /stats GET /renegcertSSL_renegotiate -> %d SSL_do_handshake() Retval %d Error waiting for client response HTTP/1.0 200 ok Content-type: text/html 
Ciphers supported in s_server binary
<>&%-11s:%-25s ---
Ciphers common between both SSL end points:
                          no client certificate available
GET /HTTP/1.0 200 ok Content-type: text/plain '%s' is an invalid file name '%s' contains '..' or ':' '%s' is an invalid path '%s' is a directory Error opening '%s' mode='%s' FILE:%s .html.php.htmrwrite W BLOCK GET /renegserver rev bufferCONNECTION FAILURE LOOKUP renego during accept CLOSE\x%02xHostname in TLS extension: "Switching server context. psk_server_cb Error: client did not send PSK identity identity_len=%d identity=%s PSK warning: client identity not what we expected (got '%s' expected '%s') PSK client identity found fetched PSK len=%ld Error in PSK server callback ALPN protocols advertised by the client: ALPN protocols selected: Lookup session: cache hit Lookup session: cache miss get sessionError encoding session get session bufferOut of memory adding to external cache Unexpected session encoding length New session added to external cache cert_status: callback called cert_status: Cannot reserve memory for OCSP responses cert_status: Cannot open OCSP response file %s cert_status: Error reading OCSP response from file %s cert_status: can't parse AIA URL cert_status: AIA URL: %s cert_status: no AIA and no default responder URL cert_status: Can't retrieve issuer certificate. cert_status: error querying responder cert_status: ocsp response sent: cert_status: number of responses: %d cert_status: no ocsp response for certificate with index %d %s: -port argument malformed or ambiguous %s: -accept argument malformed or ambiguous verify depth is %d, must return a certificate Error parsing -status_url argument Invalid value for max_early_data Invalid value for recv_max_early_data Can't use -HTTP, -www or -WWW with DTLS Can only use -listen with DTLS Can't use -rev with DTLS Can only use -tfo with TLS Can only use --stateless with TLS Can't use -early_data in combination with -rev server certificate private keyserver certificateserver certificate chainsecond server certificate private keysecond server certificatesecond certificate private keysecond server certificate chainwarning: id_prefix is too long, only one new session will be possible error setting 'id_prefix' id_prefix '%s' set. Setting secondary ctx parameters DH parametersSetting temp DH parameters Using default temp DH parameters Error setting temp DH parameters PSK key given, setting server callback PSK warning: there is NO identity hint in TLSv1.3 error setting PSK identity hint to context error setting session id context Compressing certificates Error compressing certs on ctx Error compressing certs on ctx2 Listening for TFO Configure SSL_CTX using the given configuration valuetrace protocol messagesTCP/IP port to listen on for connections (default is 4433)TCP/IP optional host and port to listen on for connections (default is *:4433)Unix domain socket to accept onunlinkFor -unix, unlink existing socket firstSet session ID contextDo not load certificates from the default certificates store URInocertDon't use any certificates (Anon-DH)VerifyTurn on peer certificate verification, must have a certServer certificate file to use; default server.pemcert2Certificate file to use for servername; default server2.pemServer certificate file format (PEM/DER/P12); has no effectServer certificate chain file in PEM formatBuild server certificate chainPEM serverinfo file for certificatePrivate key file to use; default is -cert file or elseserver.pemkey2-Private Key file to use for servername if not in -cert2dcertSecond server certificate file to use (usually for DSA)dcertformSecond server certificate file format (PEM/DER/P12); has no effectdcert_chainsecond server certificate chain file in PEM formatdkeySecond private key file to use (usually for DSA)dkeyformSecond key file format (ENGINE, other values ignored)dpassSecond private key and cert file pass phrase sourceDH parameters file to useServername for HostName TLS extensionservername_fatalOn servername mismatch send fatal alert (default warning alert)Test with the non-blocking test bioNo server outputno_resume_ephemeralDisable caching and tickets if ephemeral (EC)DH is usedwwwRespond to a 'GET /' with a status pageWWWRespond to a 'GET with the file ./pathHTTPLike -WWW but ./path includes HTTP headersid_prefixGenerate SSL/TLS session IDs prefixed by argCRL file format (PEM or DER); default PEMDownload CRLs from distribution points in certificate CDP entriesuse dir as certificate store path to build CA certificate chainuse URI as certificate store to build CA certificate chainuse dir as certificate store path to verify CA certificateuse URI as certificate store to verify CA certificateno_cacheDisable session cacheext_cacheDisable internal cache, set up and use external cacheNo verify output except verify errorsIgnore input EOF (default when -quiet)Do not ignore input EOFOCSP options: Provide certificate status response if requested, for server cert onlystatus_allProvide certificate status response(s) if requested, for the whole chainstatus_verbosePrint more output in certificate status callbackstatus_timeoutStatus request responder timeoutstatus_urlStatus request fallback URLstatus_fileFile containing DER encoded OCSP Response (can be specified multiple times)Print output from SSL/TLS security frameworkPrint more output from SSL/TLS security frameworkact as an echo server that sends back received text reversedPrint more outputPrint the SSL statesOperate in asynchronous modenacceptTerminate after #num connectionsEnable timeoutsSet link-layer MTUServer identity options: PSK identity to expectpsk_hintPSK identity hint to usesrpvfile(deprecated) The verifier file for SRPsrpuserseed(deprecated) A seed string for a default user saltmax_early_dataThe maximum number of bytes of early data as advertised in ticketsrecv_max_early_dataThe maximum number of bytes of early data (hard limit)Attempt to read early datanum_ticketsThe number of TLSv1.3 session tickets that a server will automatically issueanti_replaySwitch on anti-replay protection (default)no_anti_replaySwitch off anti-replay protectionhttp_server_binmodeopening files in binary mode when acting as http server (-WWW and -HTTP)no_ca_namesDisable TLS Extension CA NamesstatelessRequire TLSv1.3 cookiesJust talk TLSv1Just talk TLSv1.1just talk TLSv1.2just talk TLSv1.3Use any DTLS versionlistenListen for a DTLS ClientHello with a cookie and then connectJust talk DTLSv1Just talk DTLSv1.2no_dheDisable ephemeral DHSet the advertised protocols for the NPN extension (comma-separated list)Set the advertised protocols for the ALPN extension (comma-separated list)localhost:4433%s: verify depth is %d %s: -www option is too long SSL_CIPHER Now timing with session id reuse.Collecting connection statistics for %d seconds %d connections in %.2fs; %.2f connections/user sec, bytes read %ld %d connections in %ld real seconds, %ld bytes read per connection Unable to get connection starting0 connections in %ld real seconds Connection options: Where to connect as post:port (default is localhost:4433)Just time new connectionsreuseJust time connection reuseJust use TLSv1.0Turn on peer certificate verification, set depthSeconds to collect data, default 30Fetch specified page from the siteCert file to use, PEM format assumedFile with key, PEM; default is -cert filecafileunable to load SSL_SESSION Context too long Error setting id context No certificate present unable to write SSL_SESSION unable to write X509 Set the session ID contextOutput format - default PEM (PEM, DER or NSS)Print ssl session id detailsOutput certificate Don't output the encoded session infoEither -skeymgmt -or -cipher option should be specified Error creating opaque key for skeymgmt %s An opaque key identified by %s is created Provider: %s Key management: %s Key generation is the only supported operation as of now Key options as opt:value for opaque keys handlingSymmetric key management name for opaque keys handlingGenerate an opaque symmetric keyThe cipher to generate key forpk7out%s: Cannot use -%s together with -%s %s: Must have -signer before -inkey No operation (-encrypt|-sign|...) specified Error allocating PKCS7 object Bad input format for PKCS#7 file Error reading S/MIME message Error creating PKCS#7 structure Error decrypting PKCS#7 structure Bad output format for PKCS#7 file apps/smime.cAction options: Output PKCS#7 structureSigning/Encryption options: Digest algorithm to use when signing or resigningDon't translate message to textSigner certificate fileDon't include signers certificate when signingVerification/Decryption options: Recipient certificate file for decryptionEmail options: Certificate chain options: nochainset PKCS7_NOCHAIN so certificates contained in the message are not used as untrusted CAsRecipient certs, used when encryptingSIG verify failure at count %d SM2 verify init failure SM2 verify failure SM2 init sign failure SM2 sign failure EdDSA verify init failure EdDSA verify failure EdDSA sign init failure EdDSA sign failure Failed to set iv length Failed to set tag length Failed to set key and iv Couldn't set input text length Couldn't insert AAD when encrypting Failed to encrypt the data sig sign loopSIG sign failure at count %d apps/speed.cError finalizing cipher loop Failed to set iv Failed to set tag Couldn't set cipher text length Couldn't insert AAD when decrypting Failed to decrypt the data +DTP:%d:%s:%s:%d Doing %u bits %s %s ops for %ds: +DTP:%s:%s:%d Doing %s %s ops for %ds: WARNING: the error queue contains previous unhandled errors. Unhandled error in the error queue during EC key setup. EC params init failure. EC key generation failure. Failure in the job Too many fds in ASYNC_WAIT_CTX Error: max_fd (%d) must be smaller than FD_SETSIZE (%d). Decrease the value of async_jobs Failure in the select ECDSA verify failure ECDSA sign failure DSA verify failure DSA sign failure RSA decrypt failure RSA encrypt failure RSA verify failure RSA sign failure +R:%d:%s:%f %d %s ops in %.2fs %s error! md2whirlpoolripemd160+DT:%s:%d:%d Doing %s ops for %ds on %d size blocks: multiblock input buffermultiblock output bufferfailed to allocate cipher context failed to initialise cipher context Impossible negative key length: %d evp_cipher keyfailed to generate random cipher key failed to set cipher key failed to set AEAD key failed to get cipher name error setting random bytes evpError performing cipher op +H:%d+F:%d:%s:%.2fThe 'numbers' are in 1000s of bytes per second processed. type %7d bytes%-24s %11.2fk %11.2f fd buffer for do_multipipe failure Forked child %d dup failed fdopen failure with 0x%x Don't understand line '%s' from child %d Got: %s from %d +F:+F2:+F3:+F4:+F5:+F6:+F7:+F8:+F9:+F10:+H:Unknown type '%s' from child %d Waitng for child failed with 0x%x Child exited with %d Child terminated by signal %d priv+R1:%ld:%d:%.2f %ld %u bits private RSA sign ops in %.2fs +R2:%ld:%d:%.2f %ld %u bits public RSA verify ops in %.2fs +R3:%ld:%d:%.2f %ld %u bits public RSA encrypt ops in %.2fs +R4:%ld:%d:%.2f %ld %u bits private RSA decrypt ops in %.2fs +R5:%ld:%u:%.2f %ld %u bits DSA sign ops in %.2fs +R6:%ld:%u:%.2f %ld %u bits DSA verify ops in %.2fs +R7:%ld:%u:%.2f %ld %u bits ECDSA sign ops in %.2fs +R8:%ld:%u:%.2f %ld %u bits ECDSA verify ops in %.2fs +R9:%ld:%d:%.2f %ld %u-bits ECDH ops in %.2fs +R10:%ld:%u:%s:%.2f %ld %u bits %s sign ops in %.2fs +R11:%ld:%u:%s:%.2f %ld %u bits %s verify ops in %.2fs +R12:%ld:%u:%s:%.2f +R13:%ld:%u:%s:%.2f +R14:%ld:%d:%.2f %ld %u-bits FFDH ops in %.2fs +R15:%ld:%s:%.2f %ld %s KEM keygen ops in %.2fs +R16:%ld:%s:%.2f %ld %s KEM encaps ops in %.2fs +R17:%ld:%s:%.2f %ld %s KEM decaps ops in %.2fs +R18:%ld:%s:%.2f %ld %s signature keygen ops in %.2fs +R19:%ld:%s:%.2f %ld %s signature sign ops in %.2fs +R20:%ld:%s:%.2f %ld %s signature verify ops in %.2fs %s: -evp option cannot be used more than once %s: %s is an unknown cipher or digest %s: %s is an unknown digest %s: %s is an unknown cipher %s: multi argument too large %s: too many async_jobs %s: async_jobs specified but async not supported %s: Maximum offset is %d Too many KEMs registered. Change MAX_KEM_NUM. ECP-256ECP-384ECP-521Too many signatures registered. Change MAX_SIG_NUM. dsa1024dsa2048ED25519ED448ECDSASIPHASHPOLY1305CMACshaopensslrsa512rsa1024rsa2048rsa3072rsa4096rsa7680rsa15360ffdhffdh2048ffdh3072ffdh4096ffdh6144ffdh8192aescamelliaecdsaecdheddsaed25519ed448curveSM2kmaccmac%s: Unknown algorithm %s -aead can be used only with an AEAD cipher %s is not an AEAD cipher -mb can be used only with a multi-block capable cipher %s is not a multi-block capable Async mode is not supported with -mbarray of loopargsError creating the ASYNC job pool Error: buffer size too large input bufferECDH secret aECDH secret bFFDH secret aFFDH secret bError creating the ASYNC_WAIT_CTX GMACYou have chosen to measure elapsed time instead of user CPU time. HMAC namehmac(%s) Invalid cipher! Requested encryption length not a multiple of block size for %s! aes-128-gcm EVP_CIPHER_CTX_new failure Couldn't init the context Failed to set the key Failed to to encrypt the data Failed finalize the encryption Failed to get the tag Failed initializing the context Requested CMAC cipher with unsupported key length. CMAC namecmac(%s)KMAC-128KMAC-256RSA sign setup failure. No RSA sign will be done. rsa signRSA verify setup failure. No RSA verify will be done. rsa verifyRSA encrypt setup failure. No RSA encrypt will be done. rsa encryptRSA decrypt setup failure. No RSA decrypt will be done. rsa decryptDSA verify setup failure. No DSA verify will be done. ECDSA verify setup failure. No ECDSA verify will be done. ECDH key generation failure. ECDH computation failure. ECDH computations don't match. EdDSA failure. EdDSA sign failure. No EdDSA sign will be done. EdDSA verify failure. No EdDSA verify will be done. TLSv1.3+GM+Cipher+SuiteSM2 init failure. SM2 sign failure. No SM2 sign will be done. SM2 verify failure. No SM2 verify will be done. Error while initialising EVP_PKEY (out of memory?). Error while allocating EVP_PKEY_CTX. Error while initialising EVP_PKEY_CTX. Error setting DH key size for keygen. FFDH key generation failure. FFDH derivation context init failure. Assigning peer key for derivation failed. Checking size of shared secret failed. Assertion failure: shared secret too large. Shared secret derive failure. FFDH computation failure. FFDH computations don't match. rsa%u%sX25519X448Error initializing keygen ctx for %s. Error while generating KEM EVP_PKEY. Error while initializing encaps data structs for %s. RSASVEDHKEMencaps resultencaps secretMemAlloc error in encaps for %s. Encaps error for %s. Error while initializing decaps data structs for %s. KEM decaps secretMemAlloc failure in decaps for %s. Decaps error for %s. keygenencapsdecapsError initializing classic keygen ctx for %s. Error while generating signature EVP_PKEY for %s. Error while initializing signing ctx for %s. Error while initializing signing data structs for %s. Error while initializing padding for %s. Error while obtaining signature bufffer length for %s. MemAlloc error in sign for %s. Signing error for %s. Error while initializing verify ctx for %s. Error while initializing verify data structs for %s. Verify error for %s. Verify 2 error for %s. signsoptions: %s The 'numbers' are in 1000s of bytes per second processed.type failed to get name of cipher '%s' +F:%u:%s%-13s+F2:%u:%u:%f:%f:%f:%f %19ssign verify encrypt decrypt sign/s verify/s encr./s decr./s rsa %5u bits %8.6fs %8.6fs %8.6fs %8.6fs %8.1f %8.1f %8.1f %8.1f +F3:%u:%u:%f:%f %18ssign verify sign/s verify/s dsa %4u bits %8.6fs %8.6fs %8.1f %8.1f +F4:%u:%u:%f:%f %30ssign verify sign/s verify/s %4u bits ecdsa (%s) %8.4fs %8.4fs %8.1f %8.1f +F5:%u:%u:%f:%f %30sop op/s %4u bits ecdh (%s) %8.4fs %8.1f +F6:%u:%u:%s:%f:%f %4u bits EdDSA (%s) %8.4fs %8.4fs %8.1f %8.1f CurveSM2%4u bits SM2 (%s) %8.4fs %8.4fs %8.1f %8.1f +F7:%u:%u:%s:%f:%f +F8:%u:%u:%f:%f %23sop op/s %4u bits ffdh %8.4fs %8.1f +F9:%u:%f:%f:%f %31skeygen encaps decaps keygens/s encaps/s decaps/s %27s %8.6fs %8.6fs %8.6fs %9.1f %9.1f %9.1f +F10:%u:%f:%f:%f %31skeygen signs verify keygens/s sign/s verify/s ECDSA sign setup failure. No ECDSA sign will be done. DSA sign setup failure. No DSA sign will be done. secp160r1nistp192nistp224nistp256nistp384nistp521nistk163nistk233nistk283nistk409nistk571nistb163nistb233nistb283nistb409nistb571brainpoolP256r1brainpoolP256t1brainpoolP384r1brainpoolP384t1brainpoolP512r1brainpoolP512t1Ed25519Ed448ecdhp160ecdhp192ecdhp224ecdhp256ecdhp384ecdhp521ecdhk163ecdhk233ecdhk283ecdhk409ecdhk571ecdhb163ecdhb233ecdhb283ecdhb409ecdhb571ecdhbrp256r1ecdhbrp256t1ecdhbrp384r1ecdhbrp384t1ecdhbrp512r1ecdhbrp512t1ecdhx25519ecdhx448ecdsap160ecdsap192ecdsap224ecdsap256ecdsap384ecdsap521ecdsak163ecdsak233ecdsak283ecdsak409ecdsak571ecdsab163ecdsab233ecdsab283ecdsab409ecdsab571ecdsabrp256r1ecdsabrp256t1ecdsabrp384r1ecdsabrp384t1ecdsabrp512r1ecdsabrp512t1ripemdrc5-cbcrc5blowfishcast5ghashkmac128kmac256hmac(sha256)Usage: %s [options] [algorithm...] All +int options consider prefix '0' as base-8 input, prefix '0x'/'0X' as base-16 input. mbEnable (tls1>=1) multi-block mode on EVP-named ciphermrProduce machine readable outputRun benchmarks in parallelasync_jobsEnable async mode and start specified number of jobsSpecify number of primes (for RSA only)mlockLock memory for better result determinismtestmodeRun the speed command in test modeSelection options: Use EVP-named cipher or digestHMAC using EVP-named digestCMAC using EVP-named cipherTime decryption instead of encryption (only EVP)aeadBenchmark EVP-named AEAD cipher in TLS-like sequenceBenchmark KEM algorithmsBenchmark signature algorithmsTiming options: elapsedUse wall-clock time instead of CPU user time as divisorRun benchmarks for specified amount of secondsRun [non-PKI] benchmarks on custom-sized buffermisalignUse specified offset to mis-align buffersAlgorithm(s) to test (optional; otherwise tests all)MD5Error setting public key Error signing SPKAC apps/spkac.cSPKAC=%s Can't find SPKAC called "%s" Error loading SPKAC Signature OK Signature Failure spksectSpecify the name of an SPKAC-dedicated section of configurationCreate SPKAC using private keychallengeChallenge stringAlternative SPKAC nameSign new SPKAC with the specified digest (default: MD5)Don't print SPKACVerify SPKAC signatureValidating user="%s" srp_verifier="%s" srp_usersalt="%s" g="%s" N="%s" Pass %s apps/srp.cassertion failed: srp_usersalt != NULLInternal error validating SRP verifier Creating user="%s" g="%s" N="%s" Internal error creating SRP verifier gNid=%s salt ="%s" verifier ="%s" User entry%s "%s" %d = "%s" g N entry%s: Only one of -add/-delete/-modify/-list -srpvfile and -configfile cannot be specified together. Exactly one of the options -add, -delete, -modify -list must be specified. Need at least one user. -passin, -passout arguments only valid with one user. trying to read default_srp in srp default_srptrying to read srpvfile in section "%s" Trying to read SRP verifier file "%s" Database initialised Default g and NNo g and N value for index "%s" Database has no g N information. Starting user processing Processing user "%s" List all users user "%s" does not exist, ignored. t user "%s" reactivated. Cannot create srp verifier for user "%s", operation abandoned . row pointersfailed to update srpvfile user "%s" does not exist, operation ignored. user "%s" already updated, operation ignored. Verifying password for user "%s" Invalid password for user "%s", operation abandoned. Password for user "%s" ok. Cannot create srp verifier for user "%s", operation abandoned. user "%s" does not exist, operation ignored. t user "%s" revoked. t User procession done. Temporary srpvfile created. srpvfile updated. User errors %d. SRP terminating with code %d. Trying to update srpvfile. Usage: %s [options] [user...] Talk a lot while doing thingsThe particular srp definition to useAdd a user and SRP verifiermodifyModify the SRP verifier of an existing userdeleteDelete user from verifier fileList usersThe srp verifier file nameSet g and N values to be used for new verifieruserinfoAdditional info to be set for userUsername(s) to process (optional)%*sCouldn't open file or uri %s %d: %s !!! Unknown code %d: %s: %s %s: the store scheme doesn't support the given search criteria. ERROR: OSSL_STORE_load() returned NULL without eof or error indications This is an error in the loader Total found: %d %s: only one search type can be given. %s: criterion already given. %s: subject already given. %s: issuer already given. %s: serial number already given. %s: can't parse serial number argument. %s: fingerprint already given. %s: can't parse fingerprint argument. %s: alias already given. apps/storeutl.c%s: can't parse alias argument. URI%s: both -issuer and -serial must be given. Usage: %s [options] uri Search options: Search for certificates onlykeysSearch for keys onlycrlsSearch for CRLs onlySearch by subjectSearch by issuer and serial, issuer nameSearch by issuer and serial, serial numberSearch by public key fingerprint, given in hexaliasSearch by aliasRecurse through namesPrint a text form of the objectsNo PEM output, just statusuriURI of the store objectWarning: could not open file %s for reading, using serial number: 1 unable to load number from %s digest bufferbad digest, %d bytes must be specified apps/ts.cError during serial number generation.could not save serial number to %s %s: Must give only one of -query, -reply, or -verify %s: Must give one of -query, -reply, or -verify Error getting password. Using configuration from %s cannot convert %s to OID nonce buffercould not create nonce could not create query Response is not generated. Verification: invalid digest string Error loading directory %s Error loading file %s Error loading store URI %s extra untrusted certsFAILEDResponse has been generated. Typical uses: openssl ts -query [-rand file...] [-config file] [-data file] [-digest hexstring] [-tspolicy oid] [-no_nonce] [-cert] [-in file] [-out file] [-text] openssl ts -reply [-config file] [-section tsa_section] [-queryfile file] [-passin password] [-signer tsa_cert.pem] [-inkey private_key.pem] [-chain certs_file.pem] [-tspolicy oid] [-in file] [-token_in] [-out file] [-token_out] [-text] [-engine id] openssl ts -verify -CApath dir -CAfile root-cert.pem -CAstore uri -untrusted extra-certs.pem [-data file] [-digest hexstring] [-queryfile request.tsq] -in response.tsr [-token_in] ...Configuration fileSection to use within config fileFile with private key for replyFile with signer CA chainFile with trusted CA certsPath to trusted CA filesURI to trusted CA storeExtra untrusted certstoken_inInput is a PKCS#7 filetoken_outOutput is a PKCS#7 fileQuery options: Generate a TS queryFile to hashDigest (as a hex string)queryfileFile containing a TS queryPut cert request into queryVerify options: Verify a TS responsereplyGenerate a TS replytspolicyPolicy OID to useDo not include a nonceOutput text (not DER)[CRL path] %serror %d at %d depth lookup: %s error %s: X.509 store context allocation failed error %s: X.509 store context initialization failed %s: OK Chain: depth=%d: (untrusted)error %s: verification failed Recognized certificate chain purposes: %-15s %s Recognized certificate policy names: other CRLs%s: Cannot use -trusted with -CAfile, -CApath or -CAstore Print extra information about the operations being performed.A file of trusted certificatesA directory of files with trusted certificatesURI to a store of trusted certificatesDo not load the default trusted certificates fileDo not load trusted certificates from the default directoryDo not load trusted certificates from the default certificates storeA file of untrusted certificatesCRLfileFile containing one or more CRL's (in PEM format) to loadTry downloading CRL information for certificates via their CDP entriesshow_chainDisplay information about the certificate chainCertificate(s) to verify (optional; stdin used otherwise)N/AOpenSSL 3.6.0 1 Oct 2025%s (Library: %s) options: Seeding source: %s Show all dataShow build dateShow configuration directoryShow engines directoryShow modules directoryShow compiler flags usedShow some internal datatype optionsShow target build platformShow random seeding optionsShow library versionShow CPU settings infoError with certificate - error %d at depth %d %s Error while verifying certificate request self-signature Certificate request self-signature did not match the contents SHA1Invalid date format: %s Invalid extension copy option: %s %s: Invalid trust object value %s %s: Invalid reject object value %s %s: Checkend time out of range %s Cannot use -preserve_dates with -not_before option Cannot use -preserve_dates with -not_after option Cannot use -preserve_dates with -days option The -in option cannot be used with -new The -req option cannot be used with -new The -new option requires using the -key or -force_pubkey option explicitly set public keyThe -new option requires a subject to be set using -subj Cannot use both -key/-signkey and -CA option Warning: ignoring -CAkey option since -CA option is not given Warning: ignoring -CAkeyform option since -CA option is not given Warning: ignoring -CAform option since -CA option is not given Warning: ignoring -CAserial option since -CA option is not given Warning: ignoring -CAcreateserial option since -CA option is not given Warning: ignoring -extensions option without -extfile Error checking extension section %s Error: -multi cannot be used with -req or -new Warning: Reading cert request from stdin since no -in option is given certificate request inputError unpacking public key from CSR Certificate request self-signature ok Warning: ignoring -copy_extensions since neither -x509toreq nor -req is given Warning: ignoring -preserve_dates option with -req or -new We need a private key to sign with, use -key or -CAkey or -CA with private key Must not use -clrext together with -copy_extensions Warning: Reading certificate(s) from stdin since no -in or -new option is given Warning: Ignoring -ext since -clrext is given serial# buffer.srlSerial number increment failure apps/x509.cError adding extensions from section %s Must specify request signing key using -key Warning: -ext should not specify copying %s extension to CSR; ignoring this Error copying extensions from certificate serial= Certificate purposes: %s%s : Yes No Yes (WARNING code=%d) CANo modulus for this public key typenotBefore=notAfter=Unknown digest No extensions in certificate Invalid extension names: %s No extensions matched with %s Certificate will expire Certificate will not expire Bad output format specified for outfile Unable to write certificate Certificate input, or CSR input file with -req (default stdin)Private key and cert file pass-phrase sourceGenerate a certificate from scratchx509toreqOutput a certification request (rather than a certificate)Input is a CSR file (rather than a certificate)copy extensions when converting from CSR to x509 or vice versaCSR verification parameter in n:v formKey for signing, and to include unless using -force_pubkeySame as -keyOutput format (DER or PEM) - default PEMNo cert output (except for requested printing)No output (except for requested printing)Certificate printing options: Print the certificate in text formcertoptVarious certificate text printing optionsPrint the certificate fingerprintPrint certificate aliasPrint serial number valuePrint the notBefore fieldPrint the notAfter fielddatesPrint both notBefore and notAfter fieldsPrint subject DNemailPrint email address(es)Synonym for -subject_hash (for backward compat)subject_hashPrint subject hash valuesubject_hash_oldPrint old-style (MD5) subject hash valueissuer_hashPrint issuer hash valueissuer_hash_oldPrint old-style (MD5) issuer hash valueRestrict which X.509 extensions to print and/or copyocspidPrint OCSP hash values for the subject name and public keyocsp_uriPrint OCSP Responder URL(s)Print out certificate purposesPrint the public key in PEM formatProcess multiple certificatesCertificate checking options: checkendCheck whether cert expires in the next arg secondsExit 1 (failure) if so, 0 if notcheckhostCheck certificate matches hostcheckemailCheck certificate matches emailcheckipCheck certificate matches ipaddrCertificate output options: Serial number to use, overrides -CAserialnext_serialIncrement current certificate serial numberNumber of days until newly generated certificate expires - default 30preserve_datesPreserve existing validity datesset_issuerSet or override certificate issuerset_subjectSet or override certificate subject (and issuer)Alias for -set_subjectforce_pubkeyKey to be placed in new certificate or certificate requestclrextDo not take over any extensions from the source certificate or requestConfig file with X509V3 extensions to addSection of extfile to use - default: unnamed sectionSignature parameter, in n:v formCorrupt last byte of certificate signature (for test)Any supported digest, used for signing and printingMicro-CA options: Use the given CA certificate, conflicts with -keyCAformCA cert format (PEM/DER/P12); has no effectThe corresponding CA key; default is -CA argCAkeyformCA key format (ENGINE, other values ignored)CAserialFile that keeps track of CA-generated serial numberCAcreateserialCreate CA serial number file if it does not existCertificate trust output options: trustoutMark certificate PEM output as trustedsetaliasSet certificate alias (nickname)clrtrustClear all trusted purposesaddtrustTrust certificate for a given purposeclrrejectClears all the prohibited or rejected uses of the certificateaddrejectReject certificate for a given purposenullFailed to create null provider Failed to create library context <%zu bytes> ptr null unknown typeintegerUTF8 encoded stringoctet stringunsigned pointer to a pointer to an %*sEmpty list of %s (!!!) %*s%s: [%d] (arbitrary size) (max %zu bytes large)%*s %s %*s%s: %llu error getting value %lld unknown type (%u) of %zu bytes %s: unable to load provider %s Hint: use -provider-path option or OPENSSL_MODULES environment variable. apps/lib/app_provider.c%s: malformed '-provparam' option value: '%s' %s: Error setting provider '%s' parameter '%s' %s: No provider named '%s' is loaded RANDFILECan't load %s into RNG apps/lib/app_rand.cCan't duplicate %s Cannot write random bytes: apps/lib/app_x509.cdistidhexdistiderror: allocation failed error: setting distinguishing ID in certificate failed error: setting distinguishing ID in certificate signing request failed TLS handshake failure. Possibly the server requires our TLS certificate but did not receive itServer did not accept our TLS certificate, likely due to mismatch with server's trust anchor or missing revocation statusCannot authenticate server via its TLS certificate, likely due to mismatch with our trusted TLS certs or missing revocation statusThe server does not support HTTPSThe server does not support (a suitable version of) TLS%s: Can't load %s: Error on line %ld of config file "%s" config inputoid_sectionproblem loading oid section %s problem creating object %s=%s apps/lib/apps.c%s: Could not allocate %zu bytes for %s argv spacerfc_822iso_8601copyall static unsigned char %s_%d[] = { 0x000x%02X,0x%02X }; unsigned char %s[%d] = { }; 0x%02X, File name too long %s.%serror converting serial to ASN.1 format Unable to rename %s to %s Error creating random number to store in %s Unable to load number from %s Error converting number from bin to BIGNUM Error creating serial number index:(%ld,%ld,%ld) Error creating name index:(%ld,%ld,%ld) %s.attr%s.attr.%sUnable to open '%s' unique_subject = %s %s: %s name is expected to be in the format /type0=value0/type1=value1/type2=... where characters may be escaped by \. This name is not in that format: '%s' %s: Out of memory %s: Error copying %s name input %s: Missing '=' after RDN type string '%s' in %s name string %s: Escape character at end of %s name string %s warning: Skipping unknown %s name attribute "%s" %s hint: a '+' in a value string needs be escaped using '\' else a new member of a multi-valued RDN is expected %s warning: No value provided for %s name attribute "%s", skipped %s: Error adding %s name attribute "/%s=%s" TrueFalseRequire explicit Policy: %s Authority%s Policies: UserNPN buffer NOTHostname %s does%s match certificate Email %s does%s match certificate IP %s does%s match certificate subjectKeyIdentifierkeyid, issuerauthorityKeyIdentifiermissing SSL_CTXSSL_CTX given but use_ssl == 0Can't open %s, %s readingCan't open "%s" for %s, %s No configuration used Error configuring OpenSSL modules calling fstat(%s)new DBpass:env:No environment variable %s file:Can't open file %s Can't access file descriptor %s Can't open BIO for stdin Invalid password argument, missing ':' within the first %d chars Invalid password argument, starting with "%.*s" Error reading password from BIO Error getting password for %s Trying plain input string (better precede with 'pass:') Out of memory getting password for %s key parametersCRLsInternal error: nothing was requested to load from %s Out of memory loadinginput-typeNo filename or uri specified for loading Could not open file or uri for loadingInternal error trying to loadError readingCould not find of %s from %shttps://Loading %s over HTTPS is unsupported http://Unable to load %s from %s CRL via CDPUnable to load %s from %s (unexpected parameters type) has expirednot yet validerror: HTTP retrieval not allowed for %s Warning: certificate from '%s' with subject '%s' %s is not a CA certstdoutappendingassertion failed: mode == 'a' || mode == 'r' || mode == 'w'abUnable to load %s error: unable to load %s from file '%s' Warning: error while verifying CSR self-signature Warning: CSR self-signature does not match the contents %s: Can't open "%s" for writing, %s Error reading mem buffer Error writing to output file: '%s' allocate async fdstoday%s is invalid, it should be "today" or have format [CC]YYMMDDHHMMSSZ start dateend dateError setting notBefore certificate field Error setting notAfter certificate field %s: end date before start date WarningParameter %s '%s' asymmetricGenerating %s key with %d bits Warning: generating random key material may take a long time if the system has a poor entropy source %s: Error generating %s key Warning: generating random key parameters may take a long time if the system has a poor entropy source %s: Generating %s key parameters failed esc_2253esc_2254esc_ctrlesc_msbuse_quoteignore_typeshow_typedump_alldump_nostrdump_dersep_comma_plussep_comma_plus_spacesep_semi_plus_spacesep_multilinedn_revnofnamesnamelnamealignspace_eqdump_unknownRFC2253onelineca_defaultcompatibleno_headerno_versionno_serialno_signameno_validityno_subjectno_issuerno_pubkeyno_extensionsno_sigdumpno_auxno_attributesext_defaultext_errorext_parseext_dumppass phraseOpenSSL application user interfaceapps/lib/apps_ui.cCould not allocate %d bytes for %s User interface error aborted! autoEnabling auto ENGINE support dynamicSO_PATHLOADInvalid engine "%s" SET_USER_INTERFACECannot use engine "%s" Engine "%s" set. No engine specified for loading %s No engine key id specified for loading %s apps/lib/engine.corg.openssl.engine:apps/lib/engine_loader.corg.openssl.engineapps/lib/http_server.c (core dumped)error detaching from parent process group: %schild PID arrayinternal error: no matching child slot for pid: %ldchild process: %ld, exit status: %dchild process: %ld, term signal %d%swaitpid() failed: %sinternal error: no free child slotsRAND_poll() failedterminating on signal: %d*:%serror setting up accept BIOerror setting accept on port %serror printing ACCEPT stringConnection: keep-alive HTTP/1.0 200 OK %sContent-type: %s Content-Length: %d sending response, 1st line: %.*ssending response header: %s%s HTTP/1.0 %d %s GET or cannot get port listening onawaiting new connection on port %s ...awaiting next request ...request line read errorBad Requestcannot parse HTTP header: missing end of linePOST invalid %s -- URL does not begin with '/': %s HTTP/1.invalid %s -- bad HTTP/version string: %sinvalid %s request -- bad URL encoding: %scould not allocate base64 bio with size = %dHTTP request does not begin with %sPOST: %serror reading HTTP headererror parsing HTTP header: missing end of lineerror parsing HTTP header: missing ':'Connectionkeep-alivecloseerror parsing DER-encoded request contentout of memory allocating %zu bytesreceived request header:received request, 1st line: %sInvalid verbosity level %d{ }%s: Can't parse "%s" as %s number %s: Can't parse "%s" as a number valdirinfileoutfile+intlongulongPEM|DER|ENGINEPEM|DERintmaxnonneguintmaxparm%s: Bad format "%s" B64b64BASE64%s: Bad format "%s"; must be one of: NSSnsspvkP12p12PKCS12(undefined)TEXT%s: Unknown option or cipher: %s %s XTS ciphers not supported %s: AEAD ciphers not supported %s: ENC-then-MAC cipher not supported %s: Unknown option or message digest: %s %s: Value must be one of: %s apps/lib/opt.cassertion failed: unknown_name != NULLassertion failed: unknown == NULLassertion failed: unknown->valtype == 0 || unknown->valtype == '-'assertion failed: vpm != NULLassertion failed: opt > OPT_V__FIRSTassertion failed: opt < OPT_V__LAST%s: Invalid Policy %s %s: Internal error adding Policy %s %s: Invalid purpose %s %s: Internal error setting purpose %s %s: Invalid verify name %s %s: epoch time out of range %s %s: Missing argument: %s %s: Extra argument after %s: "%s" %s: Extra option: "%s" %s: Extra (unknown) options: "%s" "%s" (No additional info)-*Usage: %s [options] Valid options are: Parameters: %s %s %s: Option -%s does not take a value %s: Option -%s needs a value %s: Not a directory: %s %s: Non-positive number "%s" for option -%s %s: Negative number "%s" for option -%s %s: Invalid format "%s" for option -%s %s: Multiple %s or unknown options: -%s and -%s %s: Unknown option: -%s a hexadecimal0Xan octalmsblobhttpNOT OKNOT OK Checking cert chain %d: Subject: Suite B: %s: %s not tested ???Security callback: Version=%s%s=Public key missing%s, bits=%ds_cb.c:security_callback_debug op=0x%x digest=%s, algorithm=%s scheme=unknown(0x%04x), security bits=%d scheme=%sKeylog callback is invoked without valid file! %s: %zu-byte buffer too large to hexencode gost2012_512gost2012_256gost2001Signature Algorithms: Shared Requested +%s+0x%02Xecdsa_brainpoolP512r1_sha512ecdsa_brainpoolP384r1_sha384ecdsa_brainpoolP256r1_sha256rsa_pss_pss_sha512rsa_pss_pss_sha384rsa_pss_pss_sha256depth=%d verify error:num=%d:%s issuer= no OCSP response(s) for certificate(s) found. verify return:%d unable to get certificate from '%s' unable to get private key from '%s' Private key does not match the certificate public key error setting certificate error setting private key error setting certificate chain error building certificate chain Client Certificate Types: UNKNOWN (%d),Peer signing digest: %s Peer signature type: %s Supported Elliptic Curve Point Formats: ansiX962_compressed_primeansiX962_compressed_char2unknown(%d)groups to printSupported groups: apps/lib/s_cb.c Shared groups: Negotiated TLS1.3 group: %s Peer Temp Key: RSA, %d bits DH, %d bits ECDH, %s, %d bits %s, %d bits read from %p [%p] (%zu bytes => %zu (0x%zX)) read from %p [%p] (%zu bytes => %d) write to %p [%p] (%zu bytes => %zu (0x%zX)) write to %p [%p] (%zu bytes => %d) SSL_connectSSL_acceptundefinedreadwrite%s:%s SSL3 alert %s:%s:%s %s:failed in %s %s:error in %s >>><<<, ???, warning, fatal, RecordHeader, ChangeCipherSpec, ApplicationData, Alert, InnerContent, Handshake ???, Unknown (content_type=%d)Not TLS data or unknown version (version=%d, content_type=%d)%s %s%s [length %04lx]%s%s %02xserver nameTLS %s extension "%s" (id=%d), len=%d error setting random cookie secret memory full Failed getting peer address assertion failed: length != 0cookie generate bufferError calculating HMAC-SHA1 of buffer with secret Missing filename Server Certificateserver keyserver chainprepend cert%s: Key already specified %s: Chain already specified matched the EEsigned the peermatched the TAVerification: OK Verified peername: %s Verification error: %s TLSA hex data buffer0123456789abcdefDANE TLSA %d %d %d %s%s %s certificate at depth %d matched the peer raw public key Protocol version: %s assertion failed: num == 2Client cipher list: SCSVCiphersuite: %s Peer certificate: Hash used: %s Signature type: %s Peer used raw public key No peer certificate or raw public key Call to SSL_CONF_cmd(%s, %s) failed Error finishing context Error writing keylog file %s # SSL/TLS secrets log file, generated by OpenSSL --- No %s certificate CA names sent --- Acceptable %s certificate CA names Secure Renegotiation IS%s supported This TLS version forbids renegotiation. Supported CiphersuiteShared CiphersuiteCheck CiphersuiteTemp DH key bitsSupported CurveShared CurveCheck CurveSupported Signature AlgorithmShared Signature AlgorithmCheck Signature AlgorithmSignature Algorithm maskCertificate chain EE keyCertificate chain CA keyPeer Chain EE keyPeer Chain CA keyCertificate chain CA digestPeer chain CA digestSSL compressionSession ticketOverall ValiditySign with EE keyEE signatureCA signatureEE key parametersCA key parametersExplicitly sign with EE keyIssuer NameCertificate TypeSHA224SHA384SHA512anonymousrsa_pkcs1_sha1ecdsa_sha1rsa_pkcs1_sha256ecdsa_secp256r1_sha256rsa_pkcs1_sha384ecdsa_secp384r1_sha384rsa_pkcs1_sha512ecdsa_secp521r1_sha512rsa_pss_rsae_sha256rsa_pss_rsae_sha384rsa_pss_rsae_sha512gostr34102001gostr34102012_256gostr34102012_512max fragment lengthclient certificate URLtrusted CA keystruncated HMACstatus requestuser mappingclient authzserver authzcert typesupported_groupsEC point formatsuse SRTPsession ticketrenegotiation infosigned certificate timestampsclient cert typeserver cert typeTLS paddingnext protocolencrypt-then-macapplication layer protocol negotiationextended master secretcompress certificatekey sharesupported versionspsk kex modescertificate authoritiespost handshake auth, HelloRequest, ClientHello, ServerHello, HelloVerifyRequest, NewSessionTicket, EndOfEarlyData, EncryptedExtensions, Certificate, ServerKeyExchange, CertificateRequest, ServerHelloDone, CertificateVerify, ClientKeyExchange, Finished, CertificateUrl, CertificateStatus, SupplementalData, KeyUpdate, CompressedCertificate, NextProto, MessageHash close_notify end_of_early_data unexpected_message bad_record_mac decryption_failed record_overflow decompression_failure handshake_failure bad_certificate unsupported_certificate certificate_revoked certificate_expired certificate_unknown illegal_parameter unknown_ca access_denied decode_error decrypt_error export_restriction protocol_version insufficient_security internal_error inappropriate_fallback user_canceled no_renegotiation missing_extension unsupported_extension certificate_unobtainable unrecognized_name bad_certificate_status_response bad_certificate_hash_value unknown_psk_identity certificate_requiredSSL 3.0TLS 1.0TLS 1.1TLS 1.2TLS 1.3DTLS 1.0DTLS 1.0 (bad)RSA signDSA signRSA fixed DHDSS fixed DHECDSA signRSA fixed ECDHECDSA fixed ECDHGOST01 SignGOST12 SignIPv4 IPv6 unix apps/lib/s_socket.cassertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(ai)) && (type == 0 || type == BIO_ADDRINFO_socktype(ai)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(ai))Internal error Can't bind %saddress for %s%s%s Connecting to %s %s:%s [%s]:%sACCEPTunknown:error PID=%dassertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(res)) && (type == 0 || type == BIO_ADDRINFO_socktype(res)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(res))SRP parameters: N= g=SRP param N and g are not known params, going to check deeper. SRP param N and g rejected. SRP password bufferSRP userapps/lib/tlssrp_depr.cSRP username = "%s" User %s doesn't exist SRP parameters set: username = "%s" info="%s" Unable to set SRP username Failed to initialize SRP verifier file Cannot initialize SRP verifier file "%s":ret=%d LOOKUP done %s LOOKUP not successful process_pollReqdelayed_deliveryprocess_certConfprocess_genmcheck_client_crlprocess_cert_requestclean_transactionprocess_errorprocess_rrossl_cmp_mock_srv_set1_refCertossl_cmp_mock_srv_set1_certOutossl_cmp_mock_srv_set1_keyOutossl_cmp_mock_srv_set1_crlOutossl_cmp_mock_srv_set1_chainOutossl_cmp_mock_srv_set1_caPubsOutossl_cmp_mock_srv_set1_newWithNewossl_cmp_mock_srv_set1_newWithOldossl_cmp_mock_srv_set1_oldWithNewossl_cmp_mock_srv_set_statusInfoossl_cmp_mock_srv_set_sendErrorossl_cmp_mock_srv_set_pollCountossl_cmp_mock_srv_set_checkAfterTimeeb_S'\Vqh -| - < h -Է A v < T > < D ` ph | p p l ܸ s 0 s8 ` l s l h -й  ( p '$!$'%KyfH*'$!03  6i l  P H < X X X X X X X X X X X X X X X p - h -| - 8 -@ d 5-l / v < F *- T >< \ sd - - | "- 0 +<8 d ,<l s h - P= s s l s LP s, h -H ` sh  - - x 4- 0 -@  st (s ( s  )s$ `( p< /sp 0< -  - h -4 ( sH h sh | f s $ s p <8 D FP - s s h - , !-4 .sH 1s 2- 3s  Fs ( Gs4 | Hs Is 0 #s@ $s %p  &p 4 'p< ` -<h h - s > h - ( Bs8 | As Ds Cs d -( 8 @ 0123456789ABCDEF&GXVTRCA>;8[Ep - h -| - h -8 @ -L -t - s h - \ -  - < -D d -l - - - s h - ( Bs8 | As Ds Cs d -( 0 H >FCUROLmjgda^[Xp?<963  ;851-*'$c`]ZWTQNKHEB?<85|xurolif㟟㪟㡩write_PKIMESSAGEread_PKIMESSAGEread_write_req_respsave_free_certsprev_itemopt_strdelete_file - P= s" l s# 4 NT# h -# # s# # s# l D$ d$ sl$ $ s$ l % ' s\% % s% h -% & s(& x& s& & -& ' s' sD' l ' l ' `( N$( h( sp( l ( ( s) P) -`) ) s) ) s* H* -`* * n* l * $+ s(+ l+ sx+ + -+ , - , l d, , s, , s, h -- L- sT- l - l - s0. l x.  s. / !n/ l T/ h -/ B "s/ l 0 L0 #sT0 0 $s0 l 0 %s41 Z &s1 1 'N1 (2 (N42 |2 )N2 h -2 x: *s2 l @3 E +s\3 3 ,s3 3 -s4 T4 .-d4 4 /-4 l 5 l \5 5 0-5 6 1s 6 X6 2sh6 6 3s6 7 4s7 @H 5sX7 H 6s7 H 7s7 08 8s88 x8 9s8 8 :s8 h -8 @D ;s9  <sX9 p =s9 l 9 l 4: t: >s: $ ?s: h - ( Bs8 | As Ds Cs h - s > h -t> > -> > s> 0? s8? h? st? ? s? @ s@ l \@ @ s@ h -@ -@ @A pHA B sA A -A B s$B dB spB B sB C sC @C -PC h -C \I sC C NC 8] P= F<D] h -x] -] -] 4 -] h -] ] -] ^ -^ 8^ <H^ s^ ^ -^ ^ -^ (_ -4_ \_ -h_ _ -_ _ -_ 4` -@` \` -h` ` -` h -` c` ` c` $a /F,a @a (-Ha `a (-ha xa )-a a #-a a *-a b - b h -Lb lb <s|b b :sb b ;sb stc c Hsc | Gfc Psc h - ( Bs8 | As Ds Cs h - s > h -(d Ld sXd td C<|d d .d -d e se 8e Os@e e K-e e L-e e M-e f N- f (f -8f f sf f sf h -4 ( Esg Bs0g Pg 0<\g l g g -g ,h -8h Lh -Th h -h h !-h h "-h i --(i di .-|i i Isi j Js j h -Tj slj j 7<j j &-j k '-k Dk %-Lk lk -xk k -k g -k l -l 8l 1<@l \l 2/dl l 3:l l 5-l l 4-l 4m 6-@m h -8 m $-m m =sm -m m D>n ?sn X @s$n As4n h -8p `p -lp zwpmfc`]ZWTQNJFB@9630-(%h -| - h - r h -8r v <Hr Fdr $ <r | Fr h -8 T >r ` F s \ sd -(s h -Hs  -\s n ss -s h -s -s 4 -s -t < -t ,t -8t 4 -Tt ht -pt t <t h -H \l /t 8l <u l :4u l -l l -l 4m -@m h - ( Bs8 | As Ds Cs 1<9.C%h -| - h -8r v <,] Fu v - v Pg <8v h -8 T >8] ` Fpv h - ( Bs8 | As Ds Cs 93zqkp -y h -| - y -y sc y -y stc h -8 -,z H -Tz T >8p | f|z | -z a -z z pz L -x{ x -x{ h -4 4 s{ h s{ { s{ s j <| $| s,| h sH| l| st| -s | -| h - s > h - ( Bs8 | As Ds Cs d -( | Zyup - h -| - l -  - sc h -8r v <,] F0 h -8 T >8] ` FL -h < - h} - |} - - 8 -L d -\ h - s > h - ( Bs8 | As Ds Cs d -( l t 000h -| - - 0 -< l -x - sc h -8r v să fЃ - stc h -8 T >8] ` f( < -D -X 8 -p - s h - ( Bs8 | As Ds Cs p -, h -| - sc h -8r v <,] Fu h -8 T >8] ` Fpv -X < -h 8 -L d -\ t -| h - s > h - ( Bs8 | As Ds Cs d -( l ̇ ؇ Fh -| - s h -8r v s,] fp - stc l - - s s h -8 T >8] ` Fpv < -D - , -8 - \ -h s h - ( Bs8 | As Ds Cs ' 41h -| - Ԍ - s t - v < F8 T >` ` F s h -8 - < - s h -ȍ l -܍ - @ -H s s h - s > h - ( Bs8 | As Ds Cs >u#& h -| - y - - -В L -ؒ h - - s h -8r v <,] s <( h -8 T >8] D sL @ -L -` , - 4 - h -T -  - 8 -@ x -x{ \ sd P sp lS s s ( s pܔ l  $ -, l d ,1 - p l ܕ Fs , Gs8 - h - s > h - ( Bs8 | As Ds Cs Salted__1,7%p - h -| - -( T sX s h -8 @ d-Ę e- $ f-( T g-\ -| - l ؙ d -(  p -$ h -| - d -( D L $+05:?DINSX]bglqv{h -| - - h -  < < sL ` sp ĝ - - < --P @ .- -ģ - ( -D x - Ĥ -Ԥ -  -0 P -h - ȥ -ܥ - 0 -H h !-| "- ̦ - -8 t - #-ħ $- %- @ &-T t '- (- Ш )-  *-  +-8 ` ,-t h -8r v < h -8 T > s l| s l ( < -T x s s P= <ت d - gp -x h -| - s h -8 T > s h - s > h - ( Bs8 | As Ds Cs -ī 8 -L d -\ d -(   EBh -| - s < s 8 -0 d -T s P= <D] h -8 T > خ > ` F D s  -$ -D -d h - ( Bs8 | As Ds Cs h - s > p  #bd p - h -| - s h -8r |} -8 \ -` -` h -8 T > s pı 8 -L d -\ F- -ī h - s > h - ( Bs8 | As Ds Cs d -( l  *(&$" h -| - h -8 h -t - Ȳ -Բ - 8 -D d -l - - -г A>fJp - h -| - s 0 s s h s l - $ s, h -8 T >8p a -P h - ( Bs8 | As Ds Cs d -( ^kZWTQN gc̻ ܻ K h -| - h -8 T} - 8 -  s H -, H -, \ -l - ļ -ؼ - L -` - - -0 -X | - - ̾ -ܾ - $ -< \ -l - -ؿ - < -T t - - - - d !-D "- t - Й #- - s @ -H h - ( Bs8 | As Ds Cs [XU9dp - h -| - l| s0 0 s s l -( h -8r v <X h -8 T >8p a -P h - ( Bs8 | As Ds Cs d -( '.$!h -| - h -8r v <,] h -8 - T >8] h - ( Bs8 | As Ds Cs =:jIFC~{xtp'$! FC@960-*xh -| - - 8l !<@l \l "<dl l #:l l $-l l %-l 4m &-@m h - ,2 p L -\ p - ht -  1< 4 2p< d 3pp B s < < 4 0<< \ 4pd 5< 6< ;s  7< H 8sL 9s :s <s - h -H \ s` @ sp \I N Z ,s L0 s 0 s0 l 0 T > lk -$ D -L h -t - -  - -8 ` -l - - -  -( ` -l - s  < , << p .<l  /s 'u )s B *s< d +sl -< (p h -M LP sM M sM N s N (N n8N LN nXN |N MN N sN N sN N sN O - O HO -H XO -dO O -O O -O O -O P -,P TP -`P P -P P -P P -Q Q -$Q HQ -XQ xQ -Q Q -Q Q -Q R -$R @R -PR R -H R -R R -R h - ( Bs8 | As Ds Cs p - h -| - d -( Nyuqmie}$./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzrounds=p -t h -| - h -8r v < lk - - h -8 d - - , -4 h -L  sd J -x - - T} - - h - s > h - ( Bs8 | As Ds Cs d -( X"  &<C"Gk==Czwtqgda^[XUROLIF}h -| - v #<,] T $>8] %stc &s X" 's| - - Lh - < - I-H .s h - ( Bs8 | As Ds Cs h - s > h - { - - - - -, X -` | - h - - 8] < - -8 4o -\ - d - h - ( Bs8 | As Ds Cs h -| - s s  s 8 s@ h -8r v <,] Fp stc - h -8 T >8] ` F - s - p -4 pP l t h - - s s  s$ h - s > h - ( Bs8 | As Ds Cs }zwtqng1h -| - s h - ( Bs8 | As Ds Cs l - - h -8r v să f s -8 h -8 T >d ` F - s - -< < -l - - s < sL Ac`knpZXh -| - s l - h -8r v <,] h -8 T >8] - < - h - ( Bs8 | As Ds Cs S_qkeh -| - s y -l 4 - h - - - ( -0 d F-l G- P= J<D] h -8r v <Hr `  H> 4 -@ - - h - K-( Lsp s s < s@ T p\ x Is h - s > h - ( Bs8 | As Ds Cs H>TR8P6p - h -| - @ p p | -0 v F- h -8 - - h - ( Bs8 | As Ds Cs d -(  +68uHHHkHpHHHHHHMp -` h -| - s h -8 T >8] , - | - h - s > h - ( Bs8 | As Ds Cs d -(   3-;9)% H pp   |G p - h -| - -  - x - & -8 h -8 @ -L h - ( Bs8 | As Ds Cs d -( X d ~|yvspmi_UKGDAgg' h -| - 0 sp s  s v < F h - h -H -< P= <H l 2s`  - n ss  s "-  #- 4 $-<  %<l  &s l  ` s !-( 0 '-@ (st  )s `( *pX  +s ,s -s h( .s 4 /s<  0- h - $ s | f|z - ( >0 sP s & s| s s s 1-s h -8 T >8] ` Fpv - 8 -L d 3-\ X -` | - < -  - 8 -4 h - s > h - ( Bs8 | As Ds Cs  h -| - l - - s h -8r v s,] fp -  - stc h -8 T >8] ` f0 -T h -| s < -D -X 8 - F- h - 0 -< l -x - h - ( Bs8 | As Ds Cs h -| - 4 - h - -$ -< s h -8r v <,] 8] - - ! -! 0! -8! 4 -H! - h - s > h - ( Bs8 | As Ds Cs s`4'g:sdQAvspmiWTLD4,$+! |y"7@ ll@E<  f[@<F3'[p -< h -| - &s < s= L= 6sX= 4r -= = -= = <= h -> @ s$> \I p$> s<> d> sl> L0 s> > s> > s> $? s,? h -\? J -l? |? _p? ? `p? @ ap@ L@ bp\@ @ cp@ @ -@ h -@ p <A D F0A lA D<xA A G-A $ EsA | BEB D Cs0B h p`B n ss \l J/B 8l N<B l R:< l O-l l K-l 4m S-@m B f<B C sC 0C sDC hC -C C -sC .sC C /<D ^s$D h -xD ( F-D D >D D <D h -E 4E -H I +- I ̵ ,-pJ J -J J -J J XsJ $K Y-4K tK -K K -K K VsL LL IsTL L Z-L L -L h -L  :- M < 9-M d 8-0M 7-DM XM ;-`M xM >-M ,2 @-M M ApM M <-M M =-M N HsN < e<pN N -N N -N O -O PO [s\O O 0sO O 1sO O 3- P HP 4-XP P 2pP h - s > h -P P -P P -Q Q -$Q BFJNRW_gjpsvy|;;;;;;Lets print some clear text h -| - L= Usn 4J A- \I pTn sn $? sn o -o h -\? J -l? h -@ s0o 8l )<B \l /B l -:< l *-l l -l 4m .-Ho o -o h n`B o no n ss p <o 0p j<8p D Ftp lA <p A (-p K sp $ s q dq k<lq | fB D s0B q <q q Fq 8r <Dr xr <r r fr r ss t <4s J hsPs xs i-s I 2-s 4E E-<x h -\H I B-x I C- y PF G-XF | P-Ty x 5-y H ?-H H @>H ̵ D-y L T-y L@ Xp\@ y py dJ r>pJ h -> L 1-L ,2 c- z M dpz @ Yp@ @ Wp@ ? Vp? h -0z C JsLz dz Kspz LsC C M<D z N<z z Osz h -L { sn{ T{ tnh{ < u-{ { vn{ | w-$| P| x-`| | z-| | {-| } f-}  ^-4} < ]-D} d \-X} [-l} XM _-} } e-} M `-} M a-} PO os\O ~ H-~ N ls(~ LL mst~ N -N O -O h - s > h -P P -P P -Q Q -$Q ` ` f| - p -̂ < - /# 2h -| - Gs , Hs< t I-t 0 Fs h - ( Bs8 | As Ds Cs 1}{y$$uol    p - ] h -| - v <,] c` T >8] ` c` h -M LP sM M sM N s N (N n8N LN nXN |N MN N sN N sN N sN O - O HO -H XO -dO O -O O -O O -O P -,P TP -`P P -P P -P P -Q Q -$Q HQ -XQ xQ -Q Q -Q Q -Q R -$R @R -PR R -H R -R R -R h - ( Bs8 | As Ds Cs d -( p 2&VSOGj\nCtr @@ T X $| 4   D h  P  T H         ( p x     X | ,  0      H T ` l x      ̫ ث    ( 8 H X   ( 4 @ L X d p | Ī Ъ      0 < p - h -| - 8 -< t -x p p s Gp L-( T M-` P= F<D] h - s $| s , KsԮ - $ J-, \ N-d O- h - -  Hp x Ip$ T p` h - s > h - ( Bs8 | As Ds Cs d -( ` h p x    This is a key...4Vx4VxVx44Vx4VxVx4x4V0123456789ab@ @ @`| >z `Xu pn  @e - 0T D2 !<       ( 4 @ L X ;d p |   ;   Щ    Ġ  ?@ @r  f g hȗ iԗ j |h -| - t s| s h -8r v <,] $ < | f stc ܱ s d s h -8 s T >8] < -L - h -` h - ( Bs8 | As Ds Cs mkhddddp -ĸ h -| - 8 - P= < s s h - -, H -P | - y - h - z < d s̹ s stc s h - s > h - ( Bs8 | As Ds Cs d -( d , , 9, 9PFFFug[Xp - h -| - -s s h -  -4 T -\ t -| s s  sԽ ,t s 0 s8 H -H h -8r stc h -8 T >` -` < - h - ( Bs8 | As Ds Cs d -( !85WH}zwtqolifc`]ZTQNKh -| - P= < l s, s 8] -P h - s > h -M LP sM M sM N s N (N n8N LN nXN |N MN N sN N sN N sN O - O HO -H XO -dO O -O O -O O -O P -,P TP -`P P -P P -P P -Q Q -$Q HQ -XQ xQ -Q Q -Q Q -Q R -$R @R -PR R -H R -R R -R h - ( Bs8 | As Ds Cs 4TLp - ] h -| - s 8 - n ss h -h x: << 8l << \l /\ l : l - l - 4m -$ E <l < X -  -( h -M LP sM M sM N s N (N n8N LN nXN |N MN N sN N sN N sN O - O HO -H XO -dO O -O O -O O -O P -,P TP -`P P -P P -P P -Q Q -$Q HQ -XQ xQ -Q Q -Q Q -Q R -$R @R -PR R -H R -R R -R s h - ( Bs8 | As Ds Cs d -( p X $ -):741!h -| - h -8 - - L - -( -@  -X  -t h - H - @ - - GYvoh*'88-$! C|yvsnkheTQNKH EB?<9630}h -| - v < s< -l '- < - @s f sH $ sp s | E T >` ` f o D- < 6- h -D (-d \ sd s ,t -- 0 :-  "-  0- ( 1-0 L .-T +- ,-s n ss - h )- )-  >-$ P *-\ t ?- Fs =- ( !-4 M /-P &-p 8 $- %- h - 2M l  8 3sD d 4sp 5s h -  s  #- Fst  Gs `( n@ E- s s ` s, D <T <- < s sD ht A-h B- h -  <  F$  sP E s ;- h -@ d 7-p s 8- s $ 9-0 p s| h - s > Cs h - ( Bs8 | As Ds Cs LRF@:4P% 8W_k@2$app_http_get_asn1load_index--0 !$'* O CJo CJo?369-0A AA'A6AAAAAA&AA)AAA A A GNU )` T l x    @        $ @ L X d l  x @        `` ` `  @`( 4 D L  T L            ,  @ L #\ p     t3   ( @ 3L + )` -p / 1< **9  poh,X_ މ  5`ccPoaooT   T @} d d~ Ľ l p m h = T= |   @s 4 |$  ,l&  \@+ | . P h? T 3tH |G P6 I ` P@K l ML t _dO | flQ  m(S | sU  D{V 4 X  [  ]  ]   a  tb  dd  \\t {  f < Tf y <h h `+Xk  1l  4m  x,u  w d h{  D }  h  Ļ4  t ( l    4T < Љ v )  2(   \Vؓ  ܩ   (  0 D 8  @  d 0<  L H 3 P{ = h HT @s YL  h] T MX M4 M\ M M M Md Mp M| M M M M M M M M M M M X  X  X  X   X , X 8 X H X X X h X x X  X  X  X  X  X  X  X  X  X  X ( X 8 X H X X X h X x X  X  X  X  X  X  X , X  X  X   X  X  X  X   X ( X , X 0 X 8 X @ X H X T X \ X h X x X  X  X  X  X  X  X  X  X  X  X  X  X  X   X ( X 0 X 8 X @ X L X X X ` X h X p X x X  X  X  X  X  X  X  X  X  X < ]  L< > T< > `< > ?asn1=SEQUENCE:LDAPMessage [LDAPMessage] messageID=INTEGER:1 extendedReq=EXPLICIT:23A,IMPLICIT:0C,FORMAT:ASCII,OCT:1.3.6.1.4.1.1466.20037 ] @ T X 4   D T H     p |       , :SP@1VSz"Iq>ʼns;lIǟ D0پ[_׉t),TQޠ/$kwޢhR i&+pSFbP3K$ ke8`$ԜLz"1lՅePfeoMLoPF%ho0i](Hޙ?_ s$ ]*?'b{tbSa'z MTXItU~#Za~qM4)h^ lAsj~2?nAj)}G0 j3=S.Ys>u1GzR٦{8h~KS[Yqenfk6(ץ,9&Kښp7V#^9OCeòp[PI(1gPޛ~, Pa孽6N@} K}!ڻbG6g茪8a3MӔ> btơu,xY4cO/<8?~%r 9캐[:Xl0B71jj )F˅ 0^9""4ah7=.J[HcӖd4ѠѮl/HC!0_ޣpx. }nBܷF6MF=dQ'^v͆3;<~ w"0qt035V4Go;X ܏pAzҚ5 W wTt>O|Lfέ=P!mĮ8bl ي] {1;VhU t WmNXOXWt|K]DX .Lr"]+-`V+!9X7ʣwn3m_3.4B_ <'~݇UiUzq]:xC)I^yG.c礋TD]c,~e% O:J褃Ix߬,7>yU؜l[z[[us'y(EX#l)PQ8L5{0^t?.3tu Oeo7ͶoP^}ֻ@Ն&A>s*M\-j(uL#,re<%? Nnzzy0 -d tHN5PD0Jmk.5R&7 o{@bo]/; hitCJrl.4^v>EJzg81{T Xٔ]^PkW*];)!AG UMp⊊#6)TfX }]lHS+G4>?VCeZp>b?[P]gb)m]W 2j5](Ą%c>0WE4:wa=J]yK/%(iw|Ju.+P2COw" iX 5maJenbj9 ANHs/U7kE.&c"^ͮbN-iOA~6)Y7d@2&0`nԳD3LJǒB6>tcY 6E+6^ʫIӫc W<I]^#8 "]V2nic'NXpNl^jCElf\}\xU3K<;XyjSiWq[BI薀H|t~kT75{9O.ev XWn?L-F(:H峄GXŬ#͖^A{KS ImQم:b1\nM{QY\̭˓iqc3;#z=ok[ښٕv8ӽJpM‘MT,ߪw(*,|& QMvvEOvq,T ouMʓH0J%/I25 IBљ#*!Q'*I ϞD'A W6\~t+_j3,*'Wj@OL:].꽂^Cqշx:D&eSVODUG?B߼ iT[|IϿBOd儇 p%8ӴxO?NKsz{w,å12U5wbFa00ࢌ)D_MR("6eT_- Nۤ/7A)G7Z?AIWΠ??FtS0Mnrsy`.*}|MD؊P):)ٯ:G]33[J_[88^΁DfbdOv#ak÷3cx2; Xꭼw1Y% .b\hv#E P?Þ;TU2tF,~` {9Z qE9MڍDH1%GۘVfHLl,TCvvh oՓʛ0a ʙ/fVJ.4U+J|gmk[́\:6zдW&e=;<IJM1^O=f"}Ư<>oz/̍"(%ԔӪЅo Ur >4, E'/U>xx.әl?v:0v0JPXԹ4BNGTEeKЅS~Y Wj؟w@c!uv'A0_Ƥ0S6.ٕ)F`'o>1*N|.AO#!MtD9iK.v^De1 ,g=.ӗTES|?ɬ kr$BCR-Ӊ(vUg9ٷ jQz:;A[]3hSdÊFDloEg<"Gzy znS옂W8U:Mr7J6T?g׸nO`+Z Q30F&8ɗ2-Y8ffN{c?ҭB) (YX}\C~ c-a3QFCNa(epC!v{@'>kwmΚw١@k!ܖrϕ^%`9Tlu88MB%f V&MXqjܐ6nC,NfcHо$#.0;/3x n3' 71MC̠I-7Ӑ_1iK석+ݛX((Tl% OG®/m)=(CLyYuwVCڬBʕs&T:7d1@YrMa!BLx1|{jT8T/ڟyBʺ!+JN5=Ů'0E;C>5 S2+]XҫSeIHM]`EJ`+7c XC~ܡV^i0~v_Xϻn2Ho|ȏӆ"Iܒ Mvg@[TfHYU;췈0rBe⑧ERQ25#< ճy[Gֽ!i,cnʄ02-I*@|E6G~.[v쉌%w۔"ѩc۴CN/hP /[Kcz0.e(왡ztTЯXNP~1 ם0&0HXTZ l8y9/^!y92rɐί &_.^f/}"mh>nēB dR\ AxRv?k "r{C &&Pzɡʨ,W>PEz,Y{4谞'Ż0'ۤ7dȆLdNL{̠q4HF7ΰM9/|ϐ[7(BY5Fn)zwg+6ׁ]8hI}<60z!u`>BGI\i}<5lcbaa\bb #l=,Kr'6e8WjOQА#e<,0Z8byK ?_F&[(MߓŔKB5kiav 3 KˑzGyW= InF:˴[0% 6Z1scnTSiT؄р W&Ed+E7W0.]tRރsa!b0l6Q{QI'ݽy9=emR`ȋ3׾CM+FTDRdGlJd?!/r|&߀PԔ}qدt63XcseD %ݘݼ ,CA¡7pZj06!i>8M4G~&%&NUMJYd~r}}+,܋R V&yq Y'h=6Uwi?cp!7бWzc V;YljT-x}N [b; $N=Z>=83^7L+X%X#ƃx݉ nk7tڠZ+( Pd~(;&9VrMg7,n1Yx]'E1!ά~2v1ĺZɞt&nmC b4IʓBK#yXfܫ3"+\{.RrxJISv-.C<9ta3*UJ痦@ARfϿMɾcv58y#H`8_kg[A ^KN[Gb#ٶ.]l|U Ϭ7jO@yJy&5M>9l9_RT$|n>J@lcDRSQG.N :&S ũ֊)uͶ{d|~ HJtLS={jw/,yD7;=)ˉdKWk '/= <s}pieKtI!d3P3b[ rQ2:dsh[p\gE`W+G "sV3> !+nk ݵI6옘 ~gjz Q͡mTi j^ \g-f3"X陯 *Vm@7gzT[r֥#9xȃtyž =4D+"G1ke__]Sp7M|Jуܲ=xX9P-D#6_ߞO㌿>IyXG/!c2culnhHY4C Tg!8 @..JQݺ#f*ʜl-k}hRV/U) N] +֛Ҙ)E\UeͬSFߥX|.FF/֪!~vb; 6yUd*N;D|N7&xm$kH!g"@?զ^MUq–%GDoS+wf~z(e1ׇ)[tQ{Ѝrw oI~$2pYp}Ėa; 츜 w'5fF1jR] ,4zj!B1H'y{QK[jqE07ޢh -Zݑc_yڙ :KCpWĶύ*#o_J'2$d,9/K~e\nĶ+Q.`ug+vAB)ʷa: odqembvmkx"2cS}흂,\݅Ҭn`.vʱrP[9|ioIRg#C,|;ea޵cslp,s쇒 g֜5HH;DsY{vM[/_)n7֪O^R0 'FezC!Ipч)6f-{ 8َx'ϵEX=!Rhax(l_\=A. _5P3},;$15sƘxf1ͦ _Y:5T!j+qf;AR2RQU2O;+amhy4IC|N^1 $"5̢ [eqd>3NAT2x~OFjx?_g LQQJXd٢2T68 `2jGA;~Ŧ3gl~Ô,,iN{@M*'Z-?}QpP8M6y.+}/J ޑǯ흸le^gb:gWVJXnp)hEͥD V&ХIn"{X:RL\|{2Nd%k}v"S1kץk8 '3󚮔 m'U)?&T#<\.!#%.oT{ka Qﻹf,%v˿z/V3ّ1rJ!BNl'"峣瀻Rdf%o ;6.+OƱ[ {5-D>DG&q{mK,l!ΓI4iI>q[~^T<) Ƥax~ 국h ')|p* 9vr0^JUF_a%z=o+Ij¡ 1BCN||`貐! |cn[i=w;&'*ܕOB m 1!8\yAt (R/M0ŦaBOfc5-;q% F⧣ͿX%_ *FKfrQ6Rq!O+&PL|.Tv%H9o$dcDol?/xӷ&ۍ7M\åuLoXU2n+EH@ع<s[qw?o6Q_~PzM֣v$_[\dq6a'}}՜ZTUE-XR(eRE+alY{땁)R25ʑ2bwC,Ax'P."볥' &~9r"cyjUaA7)RN1D.A  ·bh'[ZzKs@xB(^qzx>,9r,]Ǯ)ha7}} GhFVm{Q{5 z*CH#ma@c+/aLp=xO 5mm79}3TӃe}':k悎X-8l;GXpMF4` <@2u#lWs L\~Nus-TUɼ˷Nj }Ј!C s}T}c^' n~Z M9;|s9Z}r2XqnfY֬S-FX.M}JLWTY,m=*)`DSԩ~!n^SY7qpc*)ךvGN1O*ejKCy8A65E<6Hw teThD,͇;) rLTfA=>_/Xh1WuM8}V4+@|"&}W(8qy!BRfJnGպ7|ocDݱ0mͿ4'Y}yܖ[N@k:dp$\t^gJʾNH}YbPSF[Z=spYk^*jN#8ֳ q-ܥ3ݢ>XSnx5xCcut q$aSM9 "/ԙt:cLZZo)3P'grcȈKջv۱כoz\,`. m+yF$\2T/xs u#Y[$u/R! %]OEʠTo"Ͻ#􏙧g;I5O76u% l>-29K__n~Qٳ7@}rS-~`I1Le:Mc!xk@[Iu#;ŀ`'zwK>uC&qrprp%j-yeN}\[7CfHlgdu6%Ut,(v= jZc>1)~3K(-:Q&.)G]c)emxc1rTsr&HWW('b1XzrnEg&%dE186FNq_ AȔs0Tv#"zB2Fy zy=2b)s Q#>t$ `6*(M憘|!3T O|mcs* 8Q#7f?Gos!ktOš2n2Bz=yCzC FxMg)+_pJjZ¬ǭ b,?VPr*؄1c' ^x1Kw\P7fkT]nX TF~ !1^ g2V XVB5ld ?f_>9]2Hle4P[.y b5ohiH]4ArZqGo@@pc6;)0 )qC;QWq+e!S_()O|D(AOj(P9gS,<˖A@2pe:"yj̙r}m䐵pNH`*z=$)ڽפ`-"ek(/y|CBjEO.4T}my.QMyVD7ZHH?,QFAƑrUs,tP:/mwmE i'e^4Ӂ=0C#Bv1sFa 9@zۀ, 4ԒlnOϯLwvrGќJ3nuv1w)R.R0u ͉ lW'=/\v)K xraao9N>Ǐ68%zJԠ>!9r=P]_?mU ![&+wOv,"j办VxD^`ey1#.t॔KXU346Wy.;N!\HJ`)S--o B.q1mo+#ߴ@, }}Kߑk iif[F}pm~uNwMA?bq^8K,0oI.ɚ] U:%#Вã/MUZ1u,A_uc,h˓QsI`&FP_YT͘At_ `{< 뤓ʚ'e[yn&(;smSX`\vCX$; $ET7c}t!HĔD"-->Z1ܕAX@_ڬ?*kX_Hx $< %kBl61z&v jb |I wgG!?C!F0bQrHg͞!0A4w>9g*{/@pO? vJ5NG+]tC3{I@fbz˓SԀH'KAa߿=q %qJWl!}5EjC\T_$.@ޒ#YҡL e[·Uq< $ka3B+wtyyϭW5 tqXk2]vH9#wJp>lR$ AZz^15uĖt۴Ȍ;fPGeb4X5j,Zhxdk>Nz¶vœjiV4J n5`#0d9`vQJ<:, `iJ!IT X!QG>TFٶdT/ϥ(9v[-C$oio}_x@ (eƞVpRҔJ%L.y\ՎTU%vcP"/XXykAg&lWa:}1-8b6BB$ge |oDɫLE{80X+] TIM"@P.x(x$V—,Cfr_S챱^@ H{?j!5GŊO^c`q[JO`ƺJ$ .:΍'! QU0c׍ąN'|.墣Lc9wfʠqP=5.`haCʚ#JEraww*-Va^jFJ?PֺוeSánCӁFFHNy@4q^J^Op-=:ը  9_!1trkd5a 9!f |ʡZqT(pCl{hMEF C,FN&.۰U*PD!0;#3ʣLR6?` Q qw:0!=$.:%Bjhyi.˹-Q5˾_XT0wP/W Bʅ sG 9b?g]$`)L='jPF<#9Zb?J^ISuC)"Ń Wm"$+Kg7ۏ8CD?LS.=fL=1lߖ3#GYu)wԐ ?LէA󀎱c?+sսQjȺMT8Шu"aQcOшI0G0\u؉EQ!o0o3$  (#kL:%OyO9]_4T@LZE ߡjpwFD+u2l'i\sGd+B/,i'ѵ#Ņ-CMIt~$ϜE@*(@)ɰ#~2Ƀѝ>շ}ec]]ύ p *q}ǸbpJO6%jF߾wVm%_[7̹J3cCCC@)|+6S} MRt_!\:Z%!vL|qPq'[# ![(=%*-}x~ $*\*hoVs:N#"jtx?DwQ0>|I ˊf$3;@VP澄 %Ӝlb]+}=zlTQ [GdUZ7%}!ioɊ@zp NFz۳˃#ĽԪ]1FΞugSGD%s~ЎYѲZ/9ͣ¹ǹHƘMʄl)Y5dY!3kQ^޸_ƹ"eFD#33kYtj>6P!Бl/&0ej0VboVqIZM4Xy0UlZL,YV蝯 xQUC;l -A(Пj~ Ы|}5'IQcd>amS9'Ogw:o s>z(a#+΄W~%Te̕ 0YakNCy% Hh f+vFNY LeHxC,$}ZpEl)@?[GD9rzڪ* T#7[a ~$sm@r HlF9OxFj1d 8<*+16`-t2蜓n{q%8*7Dΐ?RR"8v iXj}|,2O 7C]$'FTSbq+qAu:a)F:ck0N% U˃uk4A)jUMp쮇8 EwnW`W"ˏ3:7o림Sp!v>/E$Y2.;#x=gO7NGL-OA.-",SU+?X:0ڰ-O&8=pQQy2{-'ŜyRS"絮nUe LsjI)aF X׈^{BXEA  1W=[/_OGV? )[Iz*!,IOQmKKR,  < x  8 T q T d T  h pp % 0  8 @t h  | l      @  ( 4      4 H X h t        4 H d |         l |           4      H X l ` v H} 0 ,1 İ  H w P X $ 0 < L \ @h Ax B  C$ 4 H \ l    ( * + , -  .8 /L 0X 1h 2x 3 < F G P V Z d m( n@ o\ pp q r s t        $ 4 H ` t         C GCC: (crosstool-NG 1.28.0) 15.2.0A2aeabi(6KZ  "D̲ > | :̲ ~<̲ ( [ Ȃ 0Ȃ :̂ CЂ P% ,\$& Hg+ t \ ~ \ p  a @+  b b@ @b Db Db@ b b b l ,c c c cx e He Hex f f f @j j j m pm pm o >  > 0> @> ;L> *  , 0 ,P x S  | 7 | x  I  h l Z lh   e  \ h \>    0- . x   Xo  82 82 3 3 (6 tH    P6 H  ?  D  P@ hE K   v  E E F F FP H H H J J M M L  \  h  h] h] _ _ @O  lf h h F =  f DQ  Tm  D  m S  hs    T=  s T  z l  l  | /  Ȋ  D{ V        9   8 ? 8 @ P G P   X    T Z [ b  x   k D < H v Hd   @ ܞ   [   D   ĭ ]   h    `   8h      h]          x x ,| c C 0   `  8 L $   h t \b     V0d `Dd j 0      dd s (    f z D  T < f     8  H l l$ @      8\  @ $$  .  H  U@ ]<  g     t p  1@    L  @     0   @   *  I   @ Z   k  P    @ `@     `  P P$ l t t   - @ <L  M   o   @ <       @ ,       @   $  = 8  S   a  v `       0  8h   L    h  w  `+ 1 Vk  D  1 p4 l  Lc  4 pm  C D X X Y    _ _ e e eh r s t  | , )6؅ |@T Qt ^t @h$u x | |p P} <8  T} T}   ܁  < X $ X   w   d d  D  h {    D  D |   O 0   <  `       D  Ļ  1     4  < D     l p  @ l  4   A! D   x           \        4 $ * *  \ (\ 3` d =h  ۇ C܇ O L[< D d L jL P T X \  ` l p p th   d   p ( * 4*  l  l #p ,t m T=  )  2 8 D  2  9 A |!  `9 L`9 9 9 d9 : : r: < < < p> > > ? ? ? @ @ @X  ,K K K L L Ll M M M N N N| (  U \V f @h <  ؤ * * * * <" * 5 = D(+  x Wx a| i q y        xp t x |  $    &  d F̥ ] \ԥ    h   }  @ @  h $      ,   , , D D   H  0 0D ` t t   P <   L L     t  &,      + + 5+ + C+ ( M U _ g Ċ yȊ ̊ Њ Ԋ ؊ ܊     C         . 8 q$ =, O0 U L [ 8(  H  dH \   P   q  D       D    D  P  - -  5 5  6( $6 ,6 ,6p 6 6 6 $7 (7 (7 7 7 7 D8 H8 H8x 8 8 8 l9 p9 %p9 :   : 5: : ; E;$ < $< U$<@ T= d= cd= d> t> ut> t? ? ?4 A A A B B B LC TC TC D E E G G G `H hH hH@ H@ H I I I &8Jx J J 9J| K ,K M,KD ZpK  pM M dM0 Q Q rQ |R R R HS TS tTS T T T T T T U U U tV V V  8 8 "< *@ 3D BH JL RX W\ O` _  bX n` |@ z` `    (ؔ h @ D H      , =( 8J` X e 8qH |\ t    T( 0    < İ  0   (  x  t  td    0   " D 8 L  & ' 4   \* ? \* * * * |3 3  d9  ] M  9 R 9 H \ 9H ; ; h ;T P< d< d< = =  L xM }  } D  h  O N%O $Q @Q @Q T HT 8  Y       Y \ J e!   \ \ \] h] <  f g      ( , <  @ ؉   $       ̊     ! T T  !` !d`  $     P x  ( /!( (I, =! 0   h      | 0 H!0 W!4 a!    (  l! ț s!ț !< ! !$  !D \  p  !   ̡ ԡ   l    0 8    (   < @ h l ̨ Ԩ T `   x  ԫ ܫ  H  Į  0 !<   , L Զ          \ `  `   "@   `     8 p       "     `    ( H P h p      0   D L   H P   "  l 0 L  0     ,"           0 | d p     t         , D X    4   8 ;"8 F"< M"@ W"D  ;   `" k" \t" , " 0  4 "4 \ " 8 "  H L "L    " 8 $ ( T X  ( ` d t x , H "H F-L " d b        "  " $ "  #$  #, P x | "#| ` .# ,      :#  @#  N#  ,  0 W#0      (! # ,# d$ |$ % % 0 }  P _#P g# 1 2  2 @3 X3 3 } Es} m# 3 \  4 u# d  4 {#4  D5 X5 #X5 0 @6 6 6 7 L7 X7 d7 h7 x7 |7 j  ? @ 4B B |C C LD hD `E hE 0F 7>W>y>>l >>>?B?Y?z??@  ?<2 ???@?@ܓ  Q@w@@@@ @1 @4 @(AMAmA| }AġAAABl B,BQBxBBBB< CL CAC_CCC, , CC D D8DPDpDDDD. DDE/EHEsE  }EE4 D EG , EEEFHFhFFFFF( FG0l +GIGuGGGGH'HCHaHHk$ HHI$Ix >IeI,u tIIIIM I J  J7J^J}J JJJJK=KcKKtH pKKK KL:LVL{LLLLLMx bgbbbbb c  Kh< sx<D Gml 'Nsx   /O|P 1=c| * " 8Iv<  ,M{Xk @$N\ Yp fm | d |  (RvX 3Wx p 4W`( J ?b}4 'W~,X >[y|  8Up1Sw%E h Vv 99Vv2 D l gf 9c &I t Ust :a~@t &F\ 2Sr<bA\}4RĂ ct d t   , <d  3  (Pllh x<`, 8\}0T  [  p7aq%QX{  cy4Sw 4 _ %3  1B^zd&  (  Aq7iL  84 5a&Th a̲    /NjءT -Hq p =ZzP  )  ?P} =Wz ->% _X t     3Mo( wH  0  , J n U 4 x    `  3 _)  W s hD      L 0 & J  U P  ^ V n `0     3 q  B r     E   4 T f   Įl    Hh4}  zX3 T X7  T8  0\(GG  Rk.Il 2 L ~ d &Ghz<g8 q  >^~6 4 @ #Qph 3Wl nȧ   7SP< _ )Om "O$ ^~0  <_Ol+Qz6[w؇ E  AD  Ln@g I ps , N |     !1!J!v!!start.o$a$dabi-note.c__abi_taginit.cstatic-reloc.ccrti.ocall_weak_fncrtn.oopenssl.clh_FUNCTION_hfn_thunklh_FUNCTION_cfn_thunklh_FUNCTION_doall_thunklh_FUNCTION_doall_arg_thunkfunction_cmpfunction_hashdo_cmdSortFnByNameprog_inithelp_argvversion_argvprog_inited.1ret.0crtstuff.call_implied_fbitscmp_mock_srv.cprocess_pollReqdelayed_deliveryprocess_certConfprocess_genmprocess_cert_requestclean_transactionprocess_error.part.0process_errorprocess_rr__func__.6__func__.7__func__.5__func__.3__func__.2__func__.0__func__.8__func__.4__func__.1__func__.21__func__.20__func__.19__func__.18__func__.17__func__.16__func__.15__func__.14__func__.13__func__.12__func__.11__func__.10__func__.9asn1parse.cca.cdo_revokelookup_confdo_body.constprop.0certify.constprop.0msie_hackpreserveextfile_confcrl_reasonsCSWTCH.312HEX_DIGITS.0ciphers.cdummy_pskcmp.cprint_to_bio_errprint_to_bio_outtruststore_set_host_etcload_trustedwrite_PKIMESSAGEread_PKIMESSAGEread_write_req_respsave_free_certsprev_item.part.0opt_strsave_cert_or_deleteget_optssetup_srv_ctxsetup_request_ctxsetup_client_ctxopt_verbosityopt_certformopt_certform_sopt_keep_aliveopt_msg_timeoutopt_total_timeoutopt_popoopt_revreasonopt_crlform_sopt_repeatopt_check_afteropt_failureopt_cmdopt_crlformopt_sectionvpmopt_otherpasscmp_ctxopt_reqout_onlyreqout_only_doneopt_rspinopt_reqoutopt_reqinopt_reqin_new_tidopt_use_mock_srvrspin_in_useopt_serveropt_rspoutopt_itemopt_proxyopt_no_proxyopt_recipientopt_pathopt_tls_usedopt_tls_certopt_tls_keyopt_tls_keypassopt_tls_extraopt_tls_trustedopt_tls_hostopt_refopt_secretopt_certopt_own_trustedopt_keyopt_keypassopt_digestopt_macopt_extracertsopt_unprotected_requestsopt_trustedopt_untrustedopt_srvcertopt_expect_senderopt_ignore_keyusageopt_unprotected_errorsopt_no_cache_extracertsopt_srvcertoutopt_extracertsoutopt_cacertsoutopt_oldwitholdopt_newwithnewopt_newwitholdopt_oldwithnewopt_crlcertopt_oldcrlopt_crloutopt_cmd_sopt_infotype_sopt_profileopt_geninfoopt_templateopt_keyspecopt_newkeyopt_newkeypassopt_centralkeygenopt_newkeyoutopt_subjectopt_daysopt_reqextsopt_sansopt_san_nodefaultopt_policiesopt_policy_oidsopt_policy_oids_criticalopt_csropt_out_trustedopt_implicit_confirmopt_disable_confirmopt_certoutopt_chainoutopt_oldcertopt_issueropt_serialopt_keyform_sopt_engineopt_batchopt_portopt_max_msgsopt_srv_refopt_srv_secretopt_srv_certopt_srv_keyopt_srv_keypassopt_srv_trustedopt_srv_untrustedopt_ref_certopt_rsp_certopt_rsp_keyopt_rsp_keypassopt_rsp_crlopt_rsp_extracertsopt_rsp_capubsopt_rsp_newwithnewopt_rsp_newwitholdopt_rsp_oldwithnewopt_poll_countopt_grant_implicitconfopt_pkistatusopt_failurebitsopt_statusstringopt_send_erroropt_send_unprotectedopt_send_unprot_erropt_accept_unprotectedopt_accept_unprot_erropt_accept_raverifiedopt_keyformserver_port.21opt_infotypeopt_config__func__.29__func__.25__func__.27__func__.26__func__.24__func__.22__func__.30__func__.28cmp_vars__func__.23cms.ccms_cbload_content_infomake_names_stacksave_certsgnames_stack_printverify_errconfigutl.cprint_sectioncrl.ccrl2pkcs7.cdgst.cshow_digestsprint_outdo_fp_oneshot_signdhparam.cdsa_to_dhdsaparam.cec.cpoint_format_optionsasn1_encoding_optionsecparam.cenc.cset_hexshow_ciphersbuf.1magic.0engine.cappend_bufutil_store_caputil_do_cmds.constprop.0errstr.cfipsinstall.cself_test_eventsdo_macprint_macwrite_config_fips_section.constprop.0self_test_logfips_optsself_test_corrupt_descself_test_corrupt_typegendsa.cgenpkey.cCSWTCH.48CSWTCH.49genrsa.cinfo.ckdf.clist.csk_EVP_CIPHER_freefunc_thunkprovider_cmpdisplay_randomcollect_providersmd_cmplist_digestssk_EVP_MD_freefunc_thunkcollect_digestslegacy_md_fnkdf_cmplist_kdfssk_EVP_KDF_freefunc_thunkcollect_kdfsmac_cmplist_macssk_EVP_MAC_freefunc_thunkcollect_macslist_typelist_cipherscollect_cipherslegacy_cipher_fnencoder_cmplist_encoderssk_OSSL_ENCODER_freefunc_thunkcollect_encodersdecoder_cmplist_decoderssk_OSSL_DECODER_freefunc_thunkcollect_decoderslist_keymanagerssk_EVP_KEYMGMT_freefunc_thunkcollect_keymanagersskeymanager_cmpsignature_cmplist_signaturessk_EVP_SIGNATURE_freefunc_thunkcollect_signatureslist_tls_sigalg_capslist_provider_tls_sigalgsasymcipher_cmplist_asymcipherssk_EVP_ASYM_CIPHER_freefunc_thunkcollect_asymciphkex_cmplist_keyexchangessk_EVP_KEYEXCH_freefunc_thunkcollect_kexkem_cmplist_kemssk_EVP_KEM_freefunc_thunkcollect_kemstore_cmplist_store_loaderssk_OSSL_STORE_LOADER_freefunc_thunkcollect_store_loaderscollect_randscollect_skeymanagersrand_cmpsk_EVP_RAND_freefunc_thunksk_EVP_SKEYMGMT_freefunc_thunksk_OSSL_PROVIDER_freefunc_thunkselect_nameCSWTCH.308mac.cnseq.cocsp.cpasswd.cmd5cryptdo_passwd.constprop.0out_buf.2out_buf.0passwds_static.3ascii_dollarcov_2charrounds_prefix.1pkcs12.cjdk_trustalg_print.isra.0pkcs8.cpkeyparam.cpkeyutl.cdo_keyopprime.cprocess_numprogs.crehash.cstr_freesk_strcmpadd_entryhandle_symlinkdo_dirremove_linkshash_tableevpmdsizeevpmdnilbucket.1nilhentry.0suffixesreq.clh_OPENSSL_STRING_hash_thunklh_OPENSSL_STRING_comp_thunklh_OPENSSL_STRING_doall_thunklh_OPENSSL_STRING_doall_arg_thunkext_name_cmpexts_cleanupext_name_hashbuild_data.constprop.0req_confaddext_confrsautl.cs_client.cserverinfo_cli_parse_cbnext_proto_cbpsk_client_cbpsk_use_session_cbchecked_uint8hexdecodeprint_stuffnew_session_cbssl_servername_cbocsp_resp_cbuser_data_processpsk_identitykeymatexportlentlsa_fields.4usage.3selector.2mtype.1data.0ldap_tls_genconf.5bio_c_outc_quietc_debugpsksesssaved_errnoc_showcertsenable_server_rpknext_protokeymatexportlabelsess_outservicescert_type_rpktls_do.10tls_will.9tls_follows.8ssl_req.7ssl_request.6s_server.csk_OCSP_RESPONSE_freefunc_thunknot_resumable_sess_cbprint_statscount_reads_callbackprint_connection_infosv_bodywww_bodyrev_bodypsk_find_session_cbpsk_server_cbalpn_cbgenerate_session_idinit_session_cache_ctxadd_sessionget_sessiondel_sessioncert_status_cbaccept_sockettlscstatps_debugbio_s_outs_briefenable_client_rpks_nbios_quiets_tlsextdebugenable_timeoutssocket_mtus_nbio_testbio_s_msgearly_datas_crlfsrp_callback_parmdtlslistenstatelesswwwlocal_argclocal_argvhttp_server_binmodes_ign_eofctx2session_id_prefixfirststr.2s_time.cdoConnectionfmt_http_get_cmdsess_id.cskeyutl.csmime.csmime_cbspeed.calarmedRAND_bytes_loopSIG_keygen_loopKEM_keygen_loopFFDH_derive_key_loopECDH_EVP_derive_key_loopKEM_encaps_loopKEM_decaps_loopSIG_verify_loopSM2_verify_loopSM2_sign_loopEdDSA_verify_loopEdDSA_sign_loopEVP_Update_loop_aead_encSIG_sign_loopGHASH_loopEVP_Update_loopEVP_Update_loop_aead_decEVP_Cipher_loopsignatures_cmpkems_cmpinit_evp_cipher_ctxmac_setuppkey_print_messagekskey_print_messagemac_teardownget_ecdsarun_benchmarkECDSA_verify_loopECDSA_sign_loopRSA_decrypt_loopRSA_encrypt_loopRSA_verify_loopRSA_sign_loopprint_resultEVP_MAC_loop.isra.0HMAC_loopCMAC_loopKMAC128_loopKMAC256_loopEVP_Digest_loop.isra.0EVP_Digest_MD2_loopEVP_Digest_MDC2_loopEVP_Digest_MD4_loopMD5_loopSHA1_loopSHA256_loopSHA512_loopWHIRLPOOL_loopEVP_Digest_RMD160_loopEVP_Digest_md_loopmultiblock_speeddo_multisigs_resultslengthsaadusertimesep.1dsa512_qdsa512_gdsa512_pdsa512_pubdsa512_privdsa1024_qdsa1024_gdsa1024_pdsa1024_pubdsa1024_privdsa2048_qdsa2048_gdsa2048_pdsa2048_pubdsa2048_privevp_mac_mdnameevp_mac_ciphernametest15360test7680test4096test3072test2048test1024test512runtestnumtestmodetestmoderesultmode_opaead_ivaeaddecryptmrevp_md_namersa_resultsecdsa_resultsecdh_resultseddsa_resultssm2_resultsffdh_resultskems_resultsdomlockkems_algs_lenkems_algnamesigs_algs_lensigs_algnameevp_hmac_namealgindexevp_cmac_namemblengths_list.0doit_choicesecdsa_choicesecdh_choicesrsa_choiceshmac_key.8deskey.7key32.6gmac_iv.5aead_lengths_listrsa_keys.4dsa_bits.3ec_curves.10ed_curves.11sm2_curves.9ffdh_params.2spkac.csrp.csrp_verify_usersrp_create_userprint_user.part.0storeutl.cindent_printfts.cverify_cbnext_serialcreate_digest.constprop.0serial_cbopt_helplistverify.ccheckv_verboseversion.ccallbapp_libctx.capp_propqapp_libctxapp_params.cprint_param_octetapp_provider.cprovider_freeset_prov_paramapp_providersapp_rand.csave_rand_filerandfilesapp_x509.capps.cindex_name_qualindex_serial_LHASH_COMPindex_name_LHASH_HASHindex_serial_LHASH_HASHadapt_keyid_extset_multi_opts.part.0index_name_LHASH_COMPdo_sign_initcrls_http_cbapp_get_passload_crl_crldpnmflag_setnmflagtmstart.0pwdbio.5cert_tbl.4ex_tbl.3apps_opt_printf.capps_ui.cui_prompt_constructui_closeui_writeui_readui_openui_base_methodcolumns.cengine_loader.cengine_expectengine_eofengine_errorengine_closeengine_loadengine_openfmt.chttp_server.cnotetermkillalltermsiglog.cnames.copt.copt_number_errorvaltype2param.isra.0opt_indexdunnos_cb.cset_cert_cbsecurity_callback_debugkeylog_callbackhexencode.part.0do_print_sigalgs.isra.0bio_keylogcookie_initializedcookie_secretsdb.1scsv_id.2symbols.0chain_flagscallback_typesssl_versionssignature_tls13_scheme_listsignature_tls12_alg_listsignature_tls12_hash_listcert_type_listalert_typeshandshakestlsext_typess_socket.ctlssrp_depr.cssl_srp_verify_param_cbssl_give_srp_client_pwd_cbssl_srp_server_param_cb_udivsi3.o.udivsi3_skip_div0_test_divsi3.o.divsi3_skip_div0_test_dvmd_lnx.o__FRAME_END___DYNAMIC_GLOBAL_OFFSET_TABLE_BIO_ADDRINFO_address@OPENSSL_3.0.0OSSL_SELF_TEST_set_callback@OPENSSL_3.0.0app_providers_cleanupsignal@GLIBC_2.4chopup_argsSSL_CTX_use_PrivateKey_file@OPENSSL_3.0.0stdin@GLIBC_2.4UI_create_method@OPENSSL_3.0.0functionsSSL_get_error@OPENSSL_3.0.0EVP_get_cipherbyname@OPENSSL_3.0.0OSSL_CMP_CTX_get0_validatedSrvCert@OPENSSL_3.2.0ERR_peek_last_error@OPENSSL_3.0.0SSL_get_srp_g@OPENSSL_3.0.0OSSL_CMP_CTX_get_certConf_cb_arg@OPENSSL_3.0.0OBJ_new_nid@OPENSSL_3.0.0pkeyparam_mainCMS_final@OPENSSL_3.0.0X509_VERIFY_PARAM_lookup@OPENSSL_3.0.0EVP_RAND_gettable_params@OPENSSL_3.0.0EVP_PKEY_get_group_name@OPENSSL_3.0.0SSL_set1_initial_peer_addr@OPENSSL_3.2.0EVP_ASYM_CIPHER_do_all_provided@OPENSSL_3.0.0PEM_write_bio_RSA_PUBKEY@OPENSSL_3.0.0X509_NAME_print_ex@OPENSSL_3.0.0app_create_libctxnseq_optionsEVP_DigestSign@OPENSSL_3.0.0EVP_PKEY_CTX_set_cb@OPENSSL_3.0.0UI_add_verify_string@OPENSSL_3.0.0UI_method_get_reader@OPENSSL_3.0.0X509_REQ_print_ex@OPENSSL_3.0.0ASN1_INTEGER_get@OPENSSL_3.0.0ASN1_UNIVERSALSTRING_to_string@OPENSSL_3.0.0SSL_read@OPENSSL_3.0.0index_indexdo_X509_REQ_verifyOSSL_CMP_ATAV_get0_algId@OPENSSL_3.4.0app_load_config_internalSRP_get_default_gN@OPENSSL_3.0.0OSSL_CMP_ITAV_get0_rootCaCert@OPENSSL_3.2.0load_key_certs_crlsd2i_TS_REQ_bio@OPENSSL_3.0.0EVP_PKEY_param_check@OPENSSL_3.0.0set_up_srp_verifier_fileX509_add1_reject_object@OPENSSL_3.0.0CRYPTO_malloc_array@OPENSSL_3.6.0BIO_set_tcp_ndelay@OPENSSL_3.0.0X509_get1_ocsp@OPENSSL_3.0.0OSSL_LIB_CTX_free@OPENSSL_3.0.0SSL_CTX_free@OPENSSL_3.0.0app_http_tls_cbEVP_DigestSignUpdate@OPENSSL_3.0.0get_legacy_pkey_idOPENSSL_sk_delete@OPENSSL_3.0.0load_csrX509_CRL_print_ex@OPENSSL_3.0.0check_cert_time_stringSSL_has_pending@OPENSSL_3.0.0EVP_DigestVerifyUpdate@OPENSSL_3.0.0crl2pkcs7_optionsX509_digest_sig@OPENSSL_3.0.0EVP_CIPHER_CTX_get0_cipher@OPENSSL_3.0.0set_base_ui_methodX509_LOOKUP_ctrl_ex@OPENSSL_3.0.0PKCS12_get0_mac@OPENSSL_3.0.0BN_generate_prime_ex@OPENSSL_3.0.0OSSL_STORE_INFO_get0_PARAMS@OPENSSL_3.0.0OSSL_CMP_MSG_read@OPENSSL_3.0.0OSSL_CMP_CTX_set1_cert@OPENSSL_3.0.0EVP_MD_do_all_provided@OPENSSL_3.0.0EVP_MAC_get0_provider@OPENSSL_3.0.0EVP_CIPHER_get0_provider@OPENSSL_3.0.0X509_NAME_hash_old@OPENSSL_3.0.0SSL_SESSION_set1_master_key@OPENSSL_3.0.0OSSL_PARAM_BLD_push_BN@OPENSSL_3.0.0ossl_cmp_mock_srv_set_sendErrorEVP_EncryptUpdate@OPENSSL_3.0.0OSSL_STORE_unregister_loader@OPENSSL_3.0.0ossl_cmp_mock_srv_newSSL_SESSION_set_protocol_version@OPENSSL_3.0.0EVP_PKEY_get_base_id@OPENSSL_3.0.0EVP_MAC_CTX_set_params@OPENSSL_3.0.0TS_VERIFY_CTX_free@OPENSSL_3.0.0EVP_MD_is_a@OPENSSL_3.0.0EVP_MAC_CTX_dup@OPENSSL_3.0.0X509_VERIFY_PARAM_set_hostflags@OPENSSL_3.0.0EVP_MAC_is_a@OPENSSL_3.0.0ENGINE_init@OPENSSL_3.0.0PBE2PARAM_free@OPENSSL_3.0.0OSSL_CRMF_CERTID_get0_serialNumber@OPENSSL_3.0.0X509_ATTRIBUTE_free@OPENSSL_3.0.0SSL_set_srp_server_param@OPENSSL_3.0.0SSL_CTX_set_next_proto_select_cb@OPENSSL_3.0.0OSSL_CMP_exec_GENM_ses@OPENSSL_3.0.0EVP_PKEY_sign@OPENSSL_3.0.0CRYPTO_secure_malloc_done@OPENSSL_3.0.0NCONF_load@OPENSSL_3.0.0i2d_SSL_SESSION@OPENSSL_3.0.0SSL_set_shutdown@OPENSSL_3.0.0BIO_set_flags@OPENSSL_3.0.0SSL_clear@OPENSSL_3.0.0TS_RESP_CTX_add_failure_info@OPENSSL_3.0.0SSL_get_peer_cert_chain@OPENSSL_3.0.0EVP_ASYM_CIPHER_get0_description@OPENSSL_3.0.0pkeyutl_mainEVP_MD_names_do_all@OPENSSL_3.0.0EVP_get_digestbyname@OPENSSL_3.0.0TXT_DB_read@OPENSSL_3.0.0make_engine_urigetpid@GLIBC_2.4EVP_RAND_free@OPENSSL_3.0.0ASYNC_cleanup_thread@OPENSSL_3.0.0ERR_peek_error@OPENSSL_3.0.0PKCS12_unpack_p7encdata@OPENSSL_3.0.0EVP_ASYM_CIPHER_is_a@OPENSSL_3.0.0SRP_VBASE_get1_by_user@OPENSSL_3.0.0PKCS12_init_ex@OPENSSL_3.0.0SSL_get_SSL_CTX@OPENSSL_3.0.0setup_engine_loaderTS_REQ_set_policy_id@OPENSSL_3.0.0PKCS12_set_pbmac1_pbkdf2@OPENSSL_3.4.0OSSL_CMP_SRV_CTX_free@OPENSSL_3.0.0ENGINE_get_ciphers@OPENSSL_3.0.0ASN1_PRINTABLE_type@OPENSSL_3.0.0ts_optionsOSSL_CMP_CTX_set_http_cb@OPENSSL_3.0.0PEM_write_bio_X509_REQ_NEW@OPENSSL_3.0.0OSSL_ENCODER_free@OPENSSL_3.0.0do_X509_REQ_signSSL_CTX_set_default_verify_store@OPENSSL_3.0.0X509_VERIFY_PARAM_set1_ip@OPENSSL_3.0.0list_mainX509_new_ex@OPENSSL_3.0.0SSL_SESSION_up_ref@OPENSSL_3.0.0POLICYINFO_free@OPENSSL_3.0.0OCSP_REQUEST_new@OPENSSL_3.0.0OSSL_CMP_CTX_set1_secretValue@OPENSSL_3.0.0X509v3_get_ext@OPENSSL_3.0.0OSSL_ENCODER_CTX_set_params@OPENSSL_3.0.0SSL_stateless@OPENSSL_3.0.0BIO_new_mem_buf@OPENSSL_3.0.0SSL_select_next_proto@OPENSSL_3.0.0OSSL_STORE_LOADER_names_do_all@OPENSSL_3.0.0BIO_ADDR_free@OPENSSL_3.0.0EVP_DecryptInit_ex@OPENSSL_3.0.0i2d_CMS_bio_stream@OPENSSL_3.0.0opt_check_mdX509_EXTENSION_free@OPENSSL_3.0.0default_config_fileOSSL_CMP_ITAV_dup@OPENSSL_3.0.0X509_cmp_time@OPENSSL_3.0.0EVP_ASYM_CIPHER_up_ref@OPENSSL_3.0.0EVP_MD_CTX_get_pkey_ctx@OPENSSL_3.0.0OCSP_RESPONSE_it@OPENSSL_3.0.0EVP_PKEY_derive_set_peer@OPENSSL_3.0.0srp_mainBN_dec2bn@OPENSSL_3.0.0SMIME_write_CMS@OPENSSL_3.0.0EVP_DigestVerify@OPENSSL_3.0.0PEM_write_bio_PKCS8_PRIV_KEY_INFO@OPENSSL_3.0.0TS_TST_INFO_print_bio@OPENSSL_3.0.0TS_CONF_set_policies@OPENSSL_3.0.0EVP_KEYMGMT_is_a@OPENSSL_3.0.0EVP_KDF_fetch@OPENSSL_3.0.0load_csr_autofmtEVP_PKEY_meth_get0@OPENSSL_3.0.0UI_method_set_closer@OPENSSL_3.0.0OSSL_CMP_CTX_set0_reqExtensions@OPENSSL_3.0.0ASN1_get_object@OPENSSL_3.0.0UI_null@OPENSSL_3.0.0OSSL_trace_end@OPENSSL_3.0.0TS_CONF_set_serial@OPENSSL_3.0.0ERR_new@OPENSSL_3.0.0OSSL_STORE_LOADER_new@OPENSSL_3.0.0PKCS7_free@OPENSSL_3.0.0EVP_KDF_gettable_ctx_params@OPENSSL_3.0.0app_accessX509_SIG_free@OPENSSL_3.0.0TS_RESP_free@OPENSSL_3.0.0X509_VERIFY_PARAM_get_count@OPENSSL_3.0.0ASN1_PCTX_set_flags@OPENSSL_3.0.0CMS_digest_verify@OPENSSL_3.0.0OCSP_BASICRESP_free@OPENSSL_3.0.0crl2pkcs7_mainBIO_get_line@OPENSSL_3.0.0hex_prinSSL_CTX_set_not_resumable_session_callback@OPENSSL_3.0.0DTLSv1_listen@OPENSSL_3.0.0X509_NAME_add_entry@OPENSSL_3.0.0ciphers_mainSSL_CTX_set_verify@OPENSSL_3.0.0NETSCAPE_SPKI_sign@OPENSSL_3.0.0CMS_ReceiptRequest_create0_ex@OPENSSL_3.0.0_edatai2b_PublicKey_bio@OPENSSL_3.0.0EVP_PKEY_CTX_ctrl@OPENSSL_3.0.0fdopen@GLIBC_2.4SSL_CTX_set_ctlog_list_file@OPENSSL_3.0.0SSL_CIPHER_standard_name@OPENSSL_3.0.0ASN1_UTCTIME_free@OPENSSL_3.0.0UI_construct_prompt@OPENSSL_3.0.0SSL_get_shared_sigalgs@OPENSSL_3.0.0do_X509_CRL_signX509_PURPOSE_get0_sname@OPENSSL_3.0.0EVP_KEM_get0_name@OPENSSL_3.0.0SSL_CTX_set_srp_strength@OPENSSL_3.0.0OSSL_CMP_get1_crlUpdate@OPENSSL_3.4.0BIO_bind@OPENSSL_3.0.0SSL_session_reused@OPENSSL_3.0.0UI_set_result@OPENSSL_3.0.0print_format_errorreq_mainX509_get_extension_flags@OPENSSL_3.0.0SSL_CIPHER_get_id@OPENSSL_3.0.0OSSL_PROVIDER_available@OPENSSL_3.0.0OSSL_CMP_MSG_free@OPENSSL_3.0.0print_ssl_summaryTS_VERIFY_CTX_add_flags@OPENSSL_3.0.0BIO_ctrl@OPENSSL_3.0.0X509_REQ_set_version@OPENSSL_3.0.0SSL_callback_ctrl@OPENSSL_3.0.0app_get0_propqnseq_mainpkeyparam_optionsOSSL_DECODER_get0_description@OPENSSL_3.0.0SSL_CTX_set_cert_store@OPENSSL_3.0.0OCSP_REQUEST_free@OPENSSL_3.0.0load_cert_certsEVP_MAC_free@OPENSSL_3.0.0X509_CRL_get0_signature@OPENSSL_3.0.0X509_cmp_timeframe@OPENSSL_3.0.0EVP_CIPHER_names_do_all@OPENSSL_3.0.0app_passwdX509_NAME_dup@OPENSSL_3.0.0OPENSSL_sk_new_reserve@OPENSSL_3.0.0NETSCAPE_SPKI_set_pubkey@OPENSSL_3.0.0OSSL_CMP_MSG_get0_header@OPENSSL_3.0.0ASN1_OCTET_STRING_free@OPENSSL_3.0.0OSSL_CMP_CTX_get0_newPkey@OPENSSL_3.0.0EVP_SIGNATURE_free@OPENSSL_3.0.0version_optionsEVP_PKEY_print_public@OPENSSL_3.0.0X509_CRL_verify@OPENSSL_3.0.0EVP_PKEY_CTX_new_from_pkey@OPENSSL_3.0.0EVP_ASYM_CIPHER_names_do_all@OPENSSL_3.0.0wait_for_asyncOSSL_ENCODER_get0_provider@OPENSSL_3.0.0d2i_SSL_SESSION_ex@OPENSSL_3.2.0app_set_propqX509_REQ_new_ex@OPENSSL_3.0.0BN_bin2bn@OPENSSL_3.0.0EVP_PKEY_paramgen@OPENSSL_3.0.0BN_is_odd@OPENSSL_3.0.0OPENSSL_strlcat@OPENSSL_3.0.0X509_get_ext_count@OPENSSL_3.0.0cmp_mainX509_CRL_diff@OPENSSL_3.0.0PEM_write_bio_X509_REQ@OPENSSL_3.0.0OSSL_STORE_load@OPENSSL_3.0.0EVP_Cipher@OPENSSL_3.0.0EVP_PKEY_CTX_settable_params@OPENSSL_3.0.0tlsext_cbOPENSSL_DIR_end@OPENSSL_3.0.0make_uppercaseopt_intTS_CONF_set_ess_cert_id_digest@OPENSSL_3.0.0i2d_ASN1_TYPE@OPENSSL_3.0.0BIO_closesocket@OPENSSL_3.0.0SSL_verify_client_post_handshake@OPENSSL_3.0.0OCSP_id_get0_info@OPENSSL_3.0.0BIO_s_file@OPENSSL_3.0.0TS_RESP_verify_token@OPENSSL_3.0.0SSL_CTX_load_verify_dir@OPENSSL_3.0.0X509_LOOKUP_ctrl@OPENSSL_3.0.0load_serialNETSCAPE_SPKI_b64_encode@OPENSSL_3.0.0load_cert_passi2t_ASN1_OBJECT@OPENSSL_3.0.0SSL_CTX_get_security_callback@OPENSSL_3.0.0EVP_DigestInit_ex2@OPENSSL_3.0.0X509_REVOKED_new@OPENSSL_3.0.0X509_set0_distinguishing_id@OPENSSL_3.0.0OBJ_NAME_do_all_sorted@OPENSSL_3.0.0X509_NAME_ENTRY_free@OPENSSL_3.0.0EVP_MAC_fetch@OPENSSL_3.0.0X509_delete_ext@OPENSSL_3.0.0EVP_KEYEXCH_names_do_all@OPENSSL_3.0.0EVP_CIPHER_do_all_sorted@OPENSSL_3.0.0EVP_SKEYMGMT_fetch@OPENSSL_3.5.0SSL_CTX_set_next_protos_advertised_cb@OPENSSL_3.0.0SRP_user_pwd_free@OPENSSL_3.0.0opt_provider_option_givenOSSL_PARAM_construct_end@OPENSSL_3.0.0passwd_optionsASN1_ENUMERATED_new@OPENSSL_3.0.0EVP_KDF_gettable_params@OPENSSL_3.0.0OSSL_CMP_SRV_CTX_set_accept_unprotected@OPENSSL_3.0.0dgst_mainqsort@GLIBC_2.4print_ca_namesd2i_ASN1_TYPE@OPENSSL_3.0.0OCSP_response_get1_basic@OPENSSL_3.0.0ERR_print_errors@OPENSSL_3.0.0_IO_stdin_usedX509_CRL_set_version@OPENSSL_3.0.0SSL_get_servername@OPENSSL_3.0.0EVP_SIGNATURE_up_ref@OPENSSL_3.0.0PKCS12_SAFEBAG_get_nid@OPENSSL_3.0.0PEM_write_bio_X509_CRL@OPENSSL_3.0.0EVP_MAC_gettable_params@OPENSSL_3.0.0OSSL_PARAM_construct_utf8_ptr@OPENSSL_3.0.0configutl_optionsEVP_DecryptFinal_ex@OPENSSL_3.0.0i2d_X509_REQ_bio@OPENSSL_3.0.0rotate_indexX509_CRL_get0_nextUpdate@OPENSSL_3.0.0SSL_set_connect_state@OPENSSL_3.0.0X509_SIG_get0@OPENSSL_3.0.0PEM_X509_INFO_read_bio@OPENSSL_3.0.0OPENSSL_LH_new@OPENSSL_3.0.0X509_add_ext@OPENSSL_3.0.0SSL_SESSION_print_keylog@OPENSSL_3.0.0CMS_verify@OPENSSL_3.0.0OSSL_STORE_INFO_new_PKEY@OPENSSL_3.0.0ossl_cmp_mock_srv_set1_oldWithNewctx_set_verify_locationsSSL_alert_desc_string_long@OPENSSL_3.0.0X509_INFO_free@OPENSSL_3.0.0set_cert_timesEVP_PKEY_verify_recover@OPENSSL_3.0.0strncmp@GLIBC_2.4n_respondersverify_cookie_callbackdestroy_ui_methodbio_open_defaultEVP_MD_CTX_get1_md@OPENSSL_3.0.0help_mainUI_get_input_flags@OPENSSL_3.0.0SSL_get_verify_result@OPENSSL_3.0.0verify_mainCMS_decrypt_set1_pkey_and_peer@OPENSSL_3.0.0EVP_PKEY_CTX_set_app_data@OPENSSL_3.0.0EVP_SKEYMGMT_is_a@OPENSSL_3.5.0parse_nameENGINE_ctrl_cmd@OPENSSL_3.0.0CMS_data@OPENSSL_3.0.0SSL_get_all_async_fds@OPENSSL_3.0.0X509_getm_notAfter@OPENSSL_3.0.0get_digest_from_engineEVP_MD_get_size@OPENSSL_3.0.0ASN1_TIME_set_string@OPENSSL_3.0.0X509_load_http@OPENSSL_3.0.0PKCS7_final@OPENSSL_3.0.0SSL_ctrl@OPENSSL_3.0.0__isoc23_sscanf@GLIBC_2.38SSL_renegotiate@OPENSSL_3.0.0BIO_free_all@OPENSSL_3.0.0x509_req_ctrl_stringOSSL_STORE_LOADER_settable_ctx_params@OPENSSL_3.6.0EVP_KDF_CTX_set_params@OPENSSL_3.0.0OSSL_STORE_LOADER_get0_description@OPENSSL_3.0.0EVP_SIGNATURE_get0_name@OPENSSL_3.0.0genrsa_optionsX509_get_ext_by_OBJ@OPENSSL_3.0.0d2i_CMS_bio@OPENSSL_3.0.0OSSL_STORE_LOADER_do_all_provided@OPENSSL_3.0.0EVP_PKEY_get_bn_param@OPENSSL_3.0.0X509_VERIFY_PARAM_get0@OPENSSL_3.0.0EVP_PKEY_get0_RSA@OPENSSL_3.0.0TS_VERIFY_CTX_new@OPENSSL_3.0.0ASN1_OCTET_STRING_new@OPENSSL_3.0.0ASN1_PCTX_set_nm_flags@OPENSSL_3.0.0X509_set_version@OPENSSL_3.0.0OCSP_REQUEST_add_ext@OPENSSL_3.0.0EVP_RAND_get0_name@OPENSSL_3.0.0OCSP_cert_status_str@OPENSSL_3.0.0BIO_ADDRINFO_family@OPENSSL_3.0.0smime_optionsBIO_dump@OPENSSL_3.0.0EVP_KEYEXCH_up_ref@OPENSSL_3.0.0NCONF_get_number_e@OPENSSL_3.0.0ssl_print_point_formatsCMS_add1_signer@OPENSSL_3.0.0SSL_CTX_sess_set_remove_cb@OPENSSL_3.0.0save_indexOCSP_RESPONSE_print@OPENSSL_3.0.0SSL_get0_dane_tlsa@OPENSSL_3.0.0OSSL_CMP_CTX_set_serverPort@OPENSSL_3.0.0OSSL_CMP_CTX_push0_genm_ITAV@OPENSSL_3.0.0OSSL_CMP_get1_rootCaKeyUpdate@OPENSSL_3.2.0X509_OBJECT_get0_X509@OPENSSL_3.0.0EVP_PKEY_CTX_set_ec_paramgen_curve_nid@OPENSSL_3.0.0X509_EXTENSION_get_object@OPENSSL_3.0.0X509_VERIFY_PARAM_add0_policy@OPENSSL_3.0.0BIO_set_callback_arg@OPENSSL_3.0.0EVP_MD_get0_description@OPENSSL_3.0.0CMS_ContentInfo_free@OPENSSL_3.0.0CONF_modules_unload@OPENSSL_3.0.0EVP_KDF_names_do_all@OPENSSL_3.0.0SSL_get_current_compression@OPENSSL_3.0.0TS_MSG_IMPRINT_new@OPENSSL_3.0.0OSSL_CMP_SRV_CTX_set_send_unprotected_errors@OPENSSL_3.0.0OPENSSL_LH_free@OPENSSL_3.0.0X509_alias_set1@OPENSSL_3.0.0SSL_CTX_new_ex@OPENSSL_3.0.0EVP_PKEY_verify_message_init@OPENSSL_3.4.0PEM_read_bio_CMS@OPENSSL_3.0.0wait@GLIBC_2.4EVP_SKEYMGMT_free@OPENSSL_3.5.0UI_get0_user_data@OPENSSL_3.0.0ts_mainEVP_MD_free@OPENSSL_3.0.0SSL_handle_events@OPENSSL_3.2.0OSSL_CRMF_CERTTEMPLATE_free@OPENSSL_3.0.0CMS_RecipientInfo_kemri_get0_kdf_alg@OPENSSL_3.6.0OCSP_CERTID_free@OPENSSL_3.0.0OSSL_QUIC_client_method@OPENSSL_3.2.0OSSL_STORE_INFO_get0_CERT@OPENSSL_3.0.0OSSL_STORE_INFO_get0_NAME_description@OPENSSL_3.0.0EVP_ASYM_CIPHER_settable_ctx_params@OPENSSL_3.0.0OSSL_PROVIDER_unload@OPENSSL_3.0.0verify_stateless_cookie_callbackSSL_get_negotiated_client_cert_type@OPENSSL_3.2.0app_load_config_bioi2d_PKCS8_PRIV_KEY_INFO_bio@OPENSSL_3.0.0OSSL_ENCODER_CTX_set_passphrase@OPENSSL_3.0.0SSL_CTX_set_generate_session_id@OPENSSL_3.0.0ENGINE_get_first@OPENSSL_3.0.0X509_CRL_free@OPENSSL_3.0.0OSSL_STORE_SEARCH_free@OPENSSL_3.0.0OSSL_CMP_CTX_get1_extraCertsIn@OPENSSL_3.0.0ENGINE_load_private_key@OPENSSL_3.0.0X509_VERIFY_PARAM_free@OPENSSL_3.0.0ENGINE_ctrl@OPENSSL_3.0.0ossl_cmp_mock_srv_set1_keyOutX509_ATTRIBUTE_get0_type@OPENSSL_3.0.0X509_set_issuer_name@OPENSSL_3.0.0CMS_digest_create_ex@OPENSSL_3.0.0X509_print_ex@OPENSSL_3.0.0EVP_KEYEXCH_do_all_provided@OPENSSL_3.0.0EVP_SIGNATURE_gettable_ctx_params@OPENSSL_3.0.0X509V3_EXT_add_nconf_sk@OPENSSL_3.0.0SSL_CTX_set_srp_client_pwd_callback@OPENSSL_3.0.0ENGINE_get_next@OPENSSL_3.0.0GENERAL_NAME_get0_value@OPENSSL_3.0.0TXT_DB_free@OPENSSL_3.0.0EVP_SIGNATURE_get0_description@OPENSSL_3.0.0print_attribsEVP_ASYM_CIPHER_free@OPENSSL_3.0.0opt_unknownX509_STORE_set_verify_cb@OPENSSL_3.0.0SSL_CTX_set_psk_server_callback@OPENSSL_3.0.0EVP_DigestSignInit@OPENSSL_3.0.0next_protos_parseapp_http_get_asn1OPENSSL_sk_num@OPENSSL_3.0.0SSL_get0_peer_rpk@OPENSSL_3.2.0OPENSSL_LH_retrieve@OPENSSL_3.0.0ENGINE_ctrl_cmd_string@OPENSSL_3.0.0RAND_get0_private@OPENSSL_3.0.0X509_ALGOR_it@OPENSSL_3.0.0ERR_set_mark@OPENSSL_3.0.0strerror@GLIBC_2.4BN_check_prime@OPENSSL_3.0.0X509_NAME_delete_entry@OPENSSL_3.0.0PEM_read_bio_NETSCAPE_CERT_SEQUENCE@OPENSSL_3.0.0SSL_CTX_set0_tmp_dh_pkey@OPENSSL_3.0.0spkac_mainOSSL_ENCODER_do_all_provided@OPENSSL_3.0.0genrsa_main__udivsi3TS_VERIFY_CTX_set0_data@OPENSSL_3.4.0OSSL_CMP_CTX_set1_proxy@OPENSSL_3.0.0print_bignum_varossl_cmp_mock_srv_set1_newWithNewtls13_aes128gcmsha256_idset_up_srp_argOSSL_trace_begin@OPENSSL_3.0.0a2i_GENERAL_NAME@OPENSSL_3.0.0ASN1_PCTX_free@OPENSSL_3.0.0load_index__end__SSL_CTX_set_psk_find_session_callback@OPENSSL_3.0.0SSL_get_current_cipher@OPENSSL_3.0.0OSSL_CRMF_ATTRIBUTETYPEANDVALUE_free@OPENSSL_3.4.0ERR_print_errors_fp@OPENSSL_3.0.0EVP_KEYMGMT_do_all_provided@OPENSSL_3.0.0SSL_set_blocking_mode@OPENSSL_3.2.0ERR_set_error@OPENSSL_3.0.0prime_optionsCMS_sign_receipt@OPENSSL_3.0.0SRP_create_verifier@OPENSSL_3.0.0X509_ATTRIBUTE_get0_object@OPENSSL_3.0.0EVP_PKEY_add1_attr_by_NID@OPENSSL_3.0.0X509_free@OPENSSL_3.0.0EVP_PKEY_CTX_new@OPENSSL_3.0.0EVP_PKEY_asn1_get0@OPENSSL_3.0.0SSL_set_accept_state@OPENSSL_3.0.0opt_stringOSSL_ENCODER_get0_properties@OPENSSL_3.0.0EVP_KEYMGMT_up_ref@OPENSSL_3.0.0BIO_s_accept@OPENSSL_3.0.0TS_RESP_verify_response@OPENSSL_3.0.0BIO_socket@OPENSSL_3.0.0raw_write_stdoutOSSL_STACK_OF_X509_free@OPENSSL_3.2.0OSSL_ENCODER_get0_name@OPENSSL_3.0.0pkcs12_optionsBUF_MEM_free@OPENSSL_3.0.0ASN1_UTF8STRING_free@OPENSSL_3.0.0ENGINE_get_name@OPENSSL_3.0.0EVP_PKEY_set_int_param@OPENSSL_3.0.0OSSL_CMP_CTX_set_transfer_cb@OPENSSL_3.0.0EVP_PKEY_encrypt_init@OPENSSL_3.0.0EVP_MD_get0_provider@OPENSSL_3.0.0TS_STATUS_INFO_new@OPENSSL_3.0.0kdf_optionsOSSL_STORE_INFO_get1_PKEY@OPENSSL_3.0.0__dso_handleSSL_get0_alpn_selected@OPENSSL_3.0.0EVP_sm3@OPENSSL_3.0.0puts@GLIBC_2.4EVP_EncryptInit_ex@OPENSSL_3.0.0SSL_free@OPENSSL_3.0.0http_server_send_statusEVP_PKEY_CTX_is_a@OPENSSL_3.0.0TS_CONF_set_certs@OPENSSL_3.0.0strtok@GLIBC_2.4SSL_get_wbio@OPENSSL_3.0.0OCSP_resp_get0_signature@OPENSSL_3.0.0perror@GLIBC_2.4SSL_get_options@OPENSSL_3.0.0ocsp_optionscert_loadOPENSSL_cleanse@OPENSSL_3.0.0X509_NAME_entry_count@OPENSSL_3.0.0X509_subject_name_hash_old@OPENSSL_3.0.0CMS_uncompress@OPENSSL_3.0.0ASN1_GENERALIZEDTIME_free@OPENSSL_3.0.0gendsa_mainEVP_PKEY_CTX_get_keygen_info@OPENSSL_3.0.0i2a_ASN1_OBJECT@OPENSSL_3.0.0X509_add_cert@OPENSSL_3.0.0SSL_get_negotiated_server_cert_type@OPENSSL_3.2.0EVP_SIGNATURE_do_all_provided@OPENSSL_3.0.0EVP_PKEY_asn1_get0_info@OPENSSL_3.0.0SSL_state_string_long@OPENSSL_3.0.0SSL_CTX_set1_param@OPENSSL_3.0.0ssl_excert_freeopt_helpOSSL_PARAM_construct_uint@OPENSSL_3.0.0OSSL_ENCODER_CTX_set_passphrase_ui@OPENSSL_3.0.0EVP_PKEY_sign_init@OPENSSL_3.0.0EVP_MAC_CTX_free@OPENSSL_3.0.0DIST_POINT_free@OPENSSL_3.0.0EVP_RAND_up_ref@OPENSSL_3.0.0EVP_PKEY_get_default_digest_name@OPENSSL_3.0.0OSSL_CMP_PKISI_dup@OPENSSL_3.0.0app_isdirhttp_server_initTXT_DB_get_by_index@OPENSSL_3.0.0EVP_CIPHER_is_a@OPENSSL_3.0.0SSL_CIPHER_find@OPENSSL_3.0.0req_options__isoc23_strtoumax@GLIBC_2.38load_crlsEVP_DigestVerifyInit@OPENSSL_3.0.0EVP_PKEY_CTX_set_dsa_paramgen_q_bits@OPENSSL_3.0.0opt_check_rest_argX509_STORE_add_cert@OPENSSL_3.0.0EVP_RAND_settable_ctx_params@OPENSSL_3.0.0OSSL_CMP_SRV_CTX_get0_custom_ctx@OPENSSL_3.0.0i2d_KeyParams_bio@OPENSSL_3.0.0raw_read_stdinOBJ_obj2txt@OPENSSL_3.0.0OSSL_CMP_exec_certreq@OPENSSL_3.0.0SSL_get_srp_username@OPENSSL_3.0.0opt_prognamedestroy_engine_loaderPKCS12_create_ex2@OPENSSL_3.2.0X509_set_pubkey@OPENSSL_3.0.0EVP_KEYMGMT_gettable_params@OPENSSL_3.0.0X509_CRL_get0_lastUpdate@OPENSSL_3.0.0OSSL_CMP_ATAV_get_rsaKeyLen@OPENSSL_3.4.0BIO_s_null@OPENSSL_3.0.0ocsp_mainTS_REQ_free@OPENSSL_3.0.0errstr_mainEVP_SKEYMGMT_up_ref@OPENSSL_3.5.0NETSCAPE_SPKI_verify@OPENSSL_3.0.0OSSL_STORE_LOADER_get0_engine@OPENSSL_3.0.0OSSL_CMP_CTX_get1_newChain@OPENSSL_3.0.0BIO_ADDRINFO_next@OPENSSL_3.0.0X509_check_email@OPENSSL_3.0.0EVP_Digest@OPENSSL_3.0.0app_RAND_load_confERR_set_debug@OPENSSL_3.0.0UI_new_method@OPENSSL_3.0.0X509V3_EXT_add_nconf@OPENSSL_3.0.0PKCS5_pbe_set@OPENSSL_3.0.0BIO_lookup_ex@OPENSSL_3.0.0fileno_stdoutASYNC_WAIT_CTX_new@OPENSSL_3.0.0OSSL_STORE_open_ex@OPENSSL_3.0.0syslog@GLIBC_2.4readlink@GLIBC_2.4EVP_DecryptUpdate@OPENSSL_3.0.0pkcs8_optionsEVP_aes_256_cbc@OPENSSL_3.0.0TS_VERIFY_CTX_set0_store@OPENSSL_3.4.0i2d_OSSL_CMP_ATAVS@OPENSSL_3.4.0EVP_PKEY_free@OPENSSL_3.0.0opt_restOSSL_PROVIDER_set_default_search_path@OPENSSL_3.0.0OSSL_STORE_LOADER_get0_scheme@OPENSSL_3.0.0x509_ctrl_stringTS_RESP_get_token@OPENSSL_3.0.0ASN1_INTEGER_free@OPENSSL_3.0.0ENGINE_get_id@OPENSSL_3.0.0load_certs_multifileEVP_KEYEXCH_gettable_ctx_params@OPENSSL_3.0.0TS_CONF_set_signer_digest@OPENSSL_3.0.0EVP_CIPHER_CTX_new@OPENSSL_3.0.0SSL_CTX_set_psk_client_callback@OPENSSL_3.0.0X509_STORE_CTX_init@OPENSSL_3.0.0opt_int_argd2i_PKCS12_bio@OPENSSL_3.0.0BN_CTX_new@OPENSSL_3.0.0X509_CRL_digest@OPENSSL_3.0.0EVP_DigestFinal_ex@OPENSSL_3.0.0set_crl_nextupdateX509_add1_trust_object@OPENSSL_3.0.0verify_optionsASN1_INTEGER_set@OPENSSL_3.0.0X509_STORE_set_lookup_crls@OPENSSL_3.0.0SSL_SESSION_print@OPENSSL_3.0.0EVP_KDF_derive@OPENSSL_3.0.0TS_CONF_set_signer_key@OPENSSL_3.0.0log_get_verbosityOSSL_STORE_INFO_get0_NAME@OPENSSL_3.0.0genpkey_optionsBIO_new_fp@OPENSSL_3.0.0EVP_MD_gettable_params@OPENSSL_3.0.0PEM_read_bio_SSL_SESSION@OPENSSL_3.0.0BIO_ADDR_dup@OPENSSL_3.2.0BUF_reverse@OPENSSL_3.0.0__aeabi_idivX509_STORE_load_path@OPENSSL_3.0.0OSSL_DECODER_CTX_free@OPENSSL_3.0.0OCSP_response_create@OPENSSL_3.0.0TS_CONF_set_tsa_name@OPENSSL_3.0.0SMIME_read_PKCS7_ex@OPENSSL_3.0.0CRYPTO_free@OPENSSL_3.0.0engine_optionsPKCS12_free@OPENSSL_3.0.0BIO_new_file@OPENSSL_3.0.0UI_method_set_reader@OPENSSL_3.0.0PKCS5_pbe2_set_scrypt@OPENSSL_3.0.0OSSL_CMP_CTX_set1_server@OPENSSL_3.0.0OSSL_CMP_CTX_print_errors@OPENSSL_3.0.0setpgid@GLIBC_2.4OPENSSL_LH_insert@OPENSSL_3.0.0SSL_use_PrivateKey@OPENSSL_3.0.0X509_VERIFY_PARAM_set_auth_level@OPENSSL_3.0.0engine_mainSSL_get0_peer_CA_list@OPENSSL_3.0.0d2i_PrivateKey@OPENSSL_3.0.0SSL_net_read_desired@OPENSSL_3.2.0EVP_RAND_CTX_get_params@OPENSSL_3.0.0EVP_PKEY_asn1_get_count@OPENSSL_3.0.0X509_STORE_CTX_set0_trusted_stack@OPENSSL_3.0.0UI_method_get_opener@OPENSSL_3.0.0OCSP_response_status@OPENSSL_3.0.0SMIME_write_PKCS7@OPENSSL_3.0.0spkac_optionsputchar@GLIBC_2.4BIO_new_dgram@OPENSSL_3.0.0PEM_read_bio_PKCS8@OPENSSL_3.0.0ossl_cmp_mock_srv_set1_chainOutBIO_ADDRINFO_socktype@OPENSSL_3.0.0ENGINE_by_id@OPENSSL_3.0.0TS_STATUS_INFO_free@OPENSSL_3.0.0memset@GLIBC_2.4SRP_VBASE_init@OPENSSL_3.0.0X509_STORE_CTX_get_error_depth@OPENSSL_3.0.0SSL_waiting_for_async@OPENSSL_3.0.0OSSL_CMP_ITAV_new0_certReqTemplate@OPENSSL_3.4.0OSSL_CMP_SRV_CTX_init_trans@OPENSSL_3.3.0sess_id_mainstrspn@GLIBC_2.4EVP_PKEY_encapsulate_init@OPENSSL_3.0.0CONF_modules_load@OPENSSL_3.0.0PKCS12_SAFEBAG_get0_attrs@OPENSSL_3.0.0X509_check_private_key@OPENSSL_3.0.0TXT_DB_create_index@OPENSSL_3.0.0BN_rshift1@OPENSSL_3.0.0PKCS8_PRIV_KEY_INFO_free@OPENSSL_3.0.0CMS_RecipientInfo_kemri_set_ukm@OPENSSL_3.6.0SSL_set_verify@OPENSSL_3.0.0do_X509_verifyOSSL_CMP_SRV_CTX_set_grant_implicit_confirm@OPENSSL_3.0.0GENERAL_NAMES_free@OPENSSL_3.0.0NETSCAPE_SPKI_new@OPENSSL_3.0.0OSSL_CMP_CTX_set1_referenceValue@OPENSSL_3.0.0OSSL_CMP_CTX_set1_issuer@OPENSSL_3.0.0bio_open_ownerOSSL_LIB_CTX_new@OPENSSL_3.0.0X509_verify_cert_error_string@OPENSSL_3.0.0GENERAL_NAME_free@OPENSSL_3.0.0ossl_cmp_mock_srv_set1_newWithOldTS_RESP_CTX_new@OPENSSL_3.0.0EVP_CIPHER_do_all_provided@OPENSSL_3.0.0d2i_X509_REQ_bio@OPENSSL_3.0.0acfdfipsinstall_optionsENGINE_get_EC@OPENSSL_3.0.0OSSL_CMP_CTX_set1_pkey@OPENSSL_3.0.0BIO_ADDR_service_string@OPENSSL_3.0.0X509_NAME_oneline@OPENSSL_3.0.0TS_CONF_set_signer_cert@OPENSSL_3.0.0save_serialASN1_ITEM_get@OPENSSL_3.0.0_finiX509_subject_name_hash@OPENSSL_3.0.0EVP_MD_do_all_sorted@OPENSSL_3.0.0EVP_CIPHER_CTX_set_flags@OPENSSL_3.0.0ASN1_GENERALIZEDTIME_print@OPENSSL_3.0.0a2i_ASN1_INTEGER@OPENSSL_3.0.0OSSL_ENCODER_to_bio@OPENSSL_3.0.0BN_print@OPENSSL_3.0.0ASN1_item_print@OPENSSL_3.0.0X509_STORE_CTX_get_error@OPENSSL_3.0.0OSSL_PROVIDER_gettable_params@OPENSSL_3.0.0__libc_start_main@GLIBC_2.34EVP_CIPHER_get0_description@OPENSSL_3.0.0PKCS12_decrypt_skey@OPENSSL_3.0.0OPENSSL_LH_doall@OPENSSL_3.0.0OCSP_crl_reason_str@OPENSSL_3.0.0ASYNC_WAIT_CTX_get_all_fds@OPENSSL_3.0.0X509V3_EXT_REQ_add_nconf@OPENSSL_3.0.0X509_STORE_set_flags@OPENSSL_3.0.0OSSL_CRMF_CERTTEMPLATE_fill@OPENSSL_3.0.0DTLS_client_method@OPENSSL_3.0.0EVP_SKEYMGMT_get0_description@OPENSSL_3.5.0SSL_set_post_handshake_auth@OPENSSL_3.0.0X509_verify_cert@OPENSSL_3.0.0OSSL_PROVIDER_get0_name@OPENSSL_3.0.0EVP_PKEY_paramgen_init@OPENSSL_3.0.0CMS_RecipientInfo_kari_get0_ctx@OPENSSL_3.0.0SSL_add_file_cert_subjects_to_stack@OPENSSL_3.0.0OSSL_CRMF_CERTTEMPLATE_new@OPENSSL_3.0.0PEM_read_bio_X509_REQ@OPENSSL_3.0.0X509_ALGOR_get0@OPENSSL_3.0.0finish_engineEVP_KDF_get0_description@OPENSSL_3.0.0BIO_f_cipher@OPENSSL_3.0.0X509_VERIFY_PARAM_get0_name@OPENSSL_3.0.0EVP_KEYEXCH_get0_name@OPENSSL_3.0.0OPENSSL_sk_new@OPENSSL_3.0.0CMS_RecipientInfo_kemri_get0_ctx@OPENSSL_3.6.0OSSL_CMP_print_to_bio@OPENSSL_3.0.0pkcs12_mainopt_set_unknown_nameX509_get_signature_nid@OPENSSL_3.0.0ENGINE_get_digest_engine@OPENSSL_3.0.0OPENSSL_strncasecmp@OPENSSL_3.0.3BIO_sock_init@OPENSSL_3.0.0OSSL_STORE_INFO_get1_CRL@OPENSSL_3.0.0__bss_end__PBKDF2PARAM_free@OPENSSL_3.0.0PEM_write_bio_SSL_SESSION@OPENSSL_3.0.0EVP_DigestInit_ex@OPENSSL_3.0.0OSSL_HTTP_parse_url@OPENSSL_3.0.0EVP_PKEY_set_params@OPENSSL_3.0.0X509_check_ip_asc@OPENSSL_3.0.0OSSL_CMP_CTX_reinit@OPENSSL_3.0.0EVP_KEYMGMT_free@OPENSSL_3.0.0opt_beginopt_formatOPENSSL_sk_push@OPENSSL_3.0.0EVP_CIPHER_get_flags@OPENSSL_3.0.0SSL_CIPHER_get_version@OPENSSL_3.0.0OSSL_CMP_CTX_set1_subjectName@OPENSSL_3.0.0EVP_KDF_CTX_free@OPENSSL_3.0.0PKCS12_SAFEBAG_get0_pkcs8@OPENSSL_3.0.0OSSL_PARAM_construct_utf8_string@OPENSSL_3.0.0BN_to_ASN1_INTEGER@OPENSSL_3.0.0ca_mainX509V3_add_value@OPENSSL_3.0.0DTLS_server_method@OPENSSL_3.0.0BN_cmp@OPENSSL_3.0.0OPENSSL_uni2utf8@OPENSSL_3.0.0SSL_CTX_set_stateless_cookie_verify_cb@OPENSSL_3.0.0EVP_MAC_final@OPENSSL_3.0.0SSL_CIPHER_get_handshake_digest@OPENSSL_3.0.0OPT_PARAM_STRUI_process@OPENSSL_3.0.0OSSL_CMP_CTX_set0_newPkey@OPENSSL_3.0.0read@GLIBC_2.4enc_optionsskeyutl_optionsSSL_load_client_CA_file@OPENSSL_3.0.0X509_NAME_ENTRY_get_object@OPENSSL_3.0.0bio_to_memBIO_number_written@OPENSSL_3.0.0fileno_stdinX509_STORE_CTX_new@OPENSSL_3.0.0EVP_PKEY_print_params@OPENSSL_3.0.0set_up_dummy_srpopt_cipher_silentabort@GLIBC_2.4SSL_net_write_desired@OPENSSL_3.2.0NETSCAPE_CERT_SEQUENCE_new@OPENSSL_3.0.0CMS_decrypt_set1_password@OPENSSL_3.0.0EVP_SKEYMGMT_get0_gen_settable_params@OPENSSL_3.5.0opt_num_restOCSP_basic_add1_status@OPENSSL_3.0.0OSSL_CMP_CTX_get_status@OPENSSL_3.0.0UI_method_get_closer@OPENSSL_3.0.0SCRYPT_PARAMS_it@OPENSSL_3.0.0index_name_cmpprint_param_valuei2d_PKCS7_bio@OPENSSL_3.0.0SSL_get_version@OPENSSL_3.0.0X509_CRL_up_ref@OPENSSL_3.0.0EVP_PKEY_fromdata_init@OPENSSL_3.0.0CMS_EncryptedData_encrypt_ex@OPENSSL_3.0.0opt_verifyASN1_ITEM_lookup@OPENSSL_3.0.0OSSL_LIB_CTX_load_config@OPENSSL_3.0.0EVP_KEYEXCH_settable_ctx_params@OPENSSL_3.0.0SSL_set_session@OPENSSL_3.0.0EVP_BytesToKey@OPENSSL_3.0.0EVP_PKEY_CTX_set_rsa_keygen_bits@OPENSSL_3.0.0OCSP_basic_sign_ctx@OPENSSL_3.0.0OSSL_STORE_supports_search@OPENSSL_3.0.0sess_id_optionscorrupt_signatureTS_CONF_set_clock_precision_digits@OPENSSL_3.0.0load_keyX509_STORE_free@OPENSSL_3.0.0load_excertCONF_get1_default_config_file@OPENSSL_3.0.0X509_get1_email@OPENSSL_3.0.0X509_time_adj_ex@OPENSSL_3.0.0X509_NAME_add_entry_by_txt@OPENSSL_3.0.0__ctype_toupper_loc@GLIBC_2.4OSSL_CMP_CTX_new@OPENSSL_3.0.0EVP_RAND_do_all_provided@OPENSSL_3.0.0X509_STORE_CTX_print_verify_cb@OPENSSL_3.0.0X509_keyid_set1@OPENSSL_3.0.0SSL_CIPHER_description@OPENSSL_3.0.0EVP_RAND_fetch@OPENSSL_3.0.0OSSL_HTTP_transfer@OPENSSL_3.0.0times@GLIBC_2.4X509V3_set_nconf@OPENSSL_3.0.0unbufferOSSL_DECODER_up_ref@OPENSSL_3.0.0parse_yesnoi2d_PKCS8_bio@OPENSSL_3.0.0app_keygenprint_attributeOSSL_STORE_LOADER_set_expect@OPENSSL_3.0.0X509_NAME_new@OPENSSL_3.0.0EVP_PKEY_get_id@OPENSSL_3.0.0EVP_CIPHER_gettable_params@OPENSSL_3.0.0setbuf@GLIBC_2.4OSSL_ENCODER_CTX_new_for_pkey@OPENSSL_3.0.0PKCS12_SAFEBAG_get0_bag_type@OPENSSL_3.0.0X509_REQ_check_private_key@OPENSSL_3.0.0ASN1_STRING_set@OPENSSL_3.0.0X509_sign_ctx@OPENSSL_3.0.0http_server_get_asn1_reqEVP_KEYEXCH_get0_provider@OPENSSL_3.0.0pkey_ctrl_stringX509_LOOKUP_store@OPENSSL_3.0.0X509v3_get_ext_by_OBJ@OPENSSL_3.0.0POLICYINFO_new@OPENSSL_3.0.0X509_print@OPENSSL_3.0.0EVP_PKEY_CTX_set_dsa_paramgen_bits@OPENSSL_3.0.0PKCS12_unpack_authsafes@OPENSSL_3.0.0X509V3_conf_free@OPENSSL_3.0.0X509_VERIFY_PARAM_set_purpose@OPENSSL_3.0.0RAND_get0_public@OPENSSL_3.0.0app_RAND_writeGENERAL_NAMES_new@OPENSSL_3.0.0BUF_MEM_grow@OPENSSL_3.0.0unlink@GLIBC_2.4load_keyparams_suppressOCSP_basic_verify@OPENSSL_3.0.0OCSP_cert_to_id@OPENSSL_3.0.0BIO_s_mem@OPENSSL_3.0.0SSL_CTX_use_PrivateKey@OPENSSL_3.0.0EVP_PKEY_meth_get0_info@OPENSSL_3.0.0SSL_write_early_data@OPENSSL_3.0.0OSSL_PARAM_BLD_new@OPENSSL_3.0.0CMS_EncryptedData_decrypt@OPENSSL_3.0.0lookup_srp_userX509_STORE_CTX_new_ex@OPENSSL_3.0.0PKCS12_SAFEBAG_get0_attr@OPENSSL_3.0.0SSL_CTX_set_max_early_data@OPENSSL_3.0.0OSSL_DECODER_do_all_provided@OPENSSL_3.0.0X509_OBJECT_free@OPENSSL_3.0.0TS_RESP_CTX_set_status_info@OPENSSL_3.0.0load_crlPKCS12_SAFEBAG_get0_safes@OPENSSL_3.0.0get_nameoptX509_ALGOR_new@OPENSSL_3.0.0EVP_PKEY_CTX_set_kem_op@OPENSSL_3.0.0EVP_KEM_free@OPENSSL_3.0.0EVP_CIPHER_CTX_get_key_length@OPENSSL_3.0.0__divsi3X509_STORE_add_lookup@OPENSSL_3.0.0OSSL_STORE_INFO_get0_CRL@OPENSSL_3.0.0PEM_read_bio_PKCS7@OPENSSL_3.0.0OPENSSL_init_ssl@OPENSSL_3.0.0CMS_data_create_ex@OPENSSL_3.0.0ca_optionsRAND_bytes_ex@OPENSSL_3.0.0SSL_CTX_ctrl@OPENSSL_3.0.0kill@GLIBC_2.4EVP_ASYM_CIPHER_gettable_ctx_params@OPENSSL_3.0.0PEM_write_bio_CMS_stream@OPENSSL_3.0.0BIO_f_buffer@OPENSSL_3.0.0TS_RESP_get_tst_info@OPENSSL_3.0.0EVP_MAC_names_do_all@OPENSSL_3.0.0EVP_CipherInit_SKEY@OPENSSL_3.5.0ASN1_UTCTIME_set_string@OPENSSL_3.0.0OSSL_CMP_ITAV_new_crls@OPENSSL_3.4.0EVP_ASYM_CIPHER_fetch@OPENSSL_3.0.0i2d_TS_RESP_bio@OPENSSL_3.0.0SSL_set_SSL_CTX@OPENSSL_3.0.0X509_get0_pubkey_bitstr@OPENSSL_3.0.0TS_VERIFY_CTX_set0_certs@OPENSSL_3.4.0app_mallocstoreutl_mainX509_trust_clear@OPENSSL_3.0.0strcpy@GLIBC_2.4print_arrayX509_STORE_get0_param@OPENSSL_3.0.0UI_method_set_writer@OPENSSL_3.0.0NETSCAPE_CERT_SEQUENCE_free@OPENSSL_3.0.0NETSCAPE_SPKI_print@OPENSSL_3.0.0CMS_get0_signers@OPENSSL_3.0.0d2i_PKCS8_PRIV_KEY_INFO_bio@OPENSSL_3.0.0TS_VERIFY_CTX_set0_imprint@OPENSSL_3.4.0SSL_CONF_cmd@OPENSSL_3.0.0BN_bn2dec@OPENSSL_3.0.0SSL_is_dtls@OPENSSL_3.0.0TS_REQ_set_msg_imprint@OPENSSL_3.0.0SSL_set_msg_callback@OPENSSL_3.0.0EVP_KEYEXCH_is_a@OPENSSL_3.0.0OSSL_ENCODER_fetch@OPENSSL_3.0.0EVP_MD_xof@OPENSSL_3.4.0OSSL_CMP_CTX_reqExtensions_have_SAN@OPENSSL_3.0.0CMS_verify_receipt@OPENSSL_3.0.0OSSL_STORE_LOADER_set_eof@OPENSSL_3.0.0TS_RESP_create_response@OPENSSL_3.0.0do_serverspeed_optionscmp_optionsSSL_CTX_compress_certs@OPENSSL_3.2.0EVP_PKEY_sign_message_init@OPENSSL_3.4.0UI_OpenSSL@OPENSSL_3.0.0SSL_CTX_set_info_callback@OPENSSL_3.0.0opt_providerapp_params_freeverify_argsEVP_PKEY_verify@OPENSSL_3.0.0OSSL_CMP_MSG_dup@OPENSSL_3.0.0OBJ_sn2nid@OPENSSL_3.0.0SSL_CTX_set_srp_cb_arg@OPENSSL_3.0.0ASN1_UTF8STRING_new@OPENSSL_3.0.0SSL_CTX_set_cipher_list@OPENSSL_3.0.0PEM_write_bio_PrivateKey@OPENSSL_3.0.0i2d_PKCS8PrivateKey_bio@OPENSSL_3.0.0TXT_DB_insert@OPENSSL_3.0.0dsaparam_optionsversion_mainX509_reject_clear@OPENSSL_3.0.0OPENSSL_sk_free@OPENSSL_3.0.0SSL_CTX_sess_set_new_cb@OPENSSL_3.0.0EVP_PKEY_CTX_get0_pkey@OPENSSL_3.0.0EVP_SKEYMGMT_get0_imp_settable_params@OPENSSL_3.5.0SSL_SESSION_set1_id_context@OPENSSL_3.0.0print_nameX509_CRL_get_issuer@OPENSSL_3.0.0X509_CRL_set1_nextUpdate@OPENSSL_3.0.0EVP_SKEY_get0_skeymgmt_name@OPENSSL_3.5.0CMS_get0_SignerInfos@OPENSSL_3.0.0opt_argBIO_s_connect@OPENSSL_3.0.0OPENSSL_LH_set_thunks@OPENSSL_3.3.0X509_NAME_cmp@OPENSSL_3.0.0SSL_is_quic@OPENSSL_3.2.0OBJ_ln2nid@OPENSSL_3.0.0prime_mainX509_up_ref@OPENSSL_3.0.0EVP_KEYEXCH_get0_description@OPENSSL_3.0.0BIO_f_base64@OPENSSL_3.0.0BIO_socket_nbio@OPENSSL_3.0.0set_nameoptEVP_PKEY_encapsulate@OPENSSL_3.0.0CMS_ReceiptRequest_get0_values@OPENSSL_3.0.0SSL_SESSION_get_max_early_data@OPENSSL_3.0.0X509_REVOKED_set_serialNumber@OPENSSL_3.0.0CRYPTO_realloc_array@OPENSSL_3.6.0X509_get_issuer_name@OPENSSL_3.0.0EVP_Q_mac@OPENSSL_3.0.0PKCS7_new@OPENSSL_3.0.0OSSL_PROVIDER_get_capabilities@OPENSSL_3.0.0EVP_MD_settable_ctx_params@OPENSSL_3.0.0NETSCAPE_SPKI_b64_decode@OPENSSL_3.0.0load_certsOSSL_ENCODER_settable_ctx_params@OPENSSL_3.0.0OSSL_CMP_CTX_set_transfer_cb_arg@OPENSSL_3.0.0OSSL_PARAM_free@OPENSSL_3.0.0EVP_PKEY_get0_type_name@OPENSSL_3.0.0strtod@GLIBC_2.4PKCS12_SAFEBAG_set0_attrs@OPENSSL_3.2.0ASN1_i2d_bio@OPENSSL_3.0.0EVP_CipherInit_ex@OPENSSL_3.0.0ASN1_OBJECT_free@OPENSSL_3.0.0X509_PURPOSE_get_id@OPENSSL_3.0.0gendsa_optionsX509_CRL_add1_ext_i2d@OPENSSL_3.0.0__aeabi_idiv0SSL_new@OPENSSL_3.0.0X509_POLICY_NODE_print@OPENSSL_3.0.0SSL_set_bio@OPENSSL_3.0.0dsaparam_mainNETSCAPE_SPKI_free@OPENSSL_3.0.0i2d_RSA_PUBKEY_bio@OPENSSL_3.0.0EVP_KEM_up_ref@OPENSSL_3.0.0do_updatedbSSL_CTX_set0_security_ex_data@OPENSSL_3.0.0cms_optionsEVP_MAC_settable_ctx_params@OPENSSL_3.0.0EVP_ASYM_CIPHER_get0_name@OPENSSL_3.0.0X509_get0_pubkey@OPENSSL_3.0.0dump_certs_pkeys_bagsEVP_KDF_up_ref@OPENSSL_3.0.0UI_method_set_prompt_constructor@OPENSSL_3.0.0EVP_read_pw_string@OPENSSL_3.0.0CRYPTO_secure_malloc_init@OPENSSL_3.0.0OSSL_CMP_MSG_get0_certreq_publickey@OPENSSL_3.3.0EVP_PKEY_decrypt@OPENSSL_3.0.0ssl_load_storesx509_mainSSL_SESSION_new@OPENSSL_3.0.0X509_REQ_add_extensions@OPENSSL_3.0.0waitpid@GLIBC_2.4SMIME_read_CMS_ex@OPENSSL_3.0.0PBEPARAM_free@OPENSSL_3.0.0X509_STORE_CTX_set_flags@OPENSSL_3.0.0EVP_PKEY_new_raw_private_key@OPENSSL_3.0.0EVP_CIPHER_CTX_rand_key@OPENSSL_3.0.0X509_REQ_sign_ctx@OPENSSL_3.0.0EVP_RAND_gettable_ctx_params@OPENSSL_3.0.0s_time_mainBIO_free@OPENSSL_3.0.0EVP_MAC_get0_description@OPENSSL_3.0.0SSL_CTX_set_srp_verify_param_callback@OPENSSL_3.0.0OSSL_CMP_CTX_set_log_cb@OPENSSL_3.0.0EVP_KEM_do_all_provided@OPENSSL_3.0.0TS_CONF_set_ess_cert_id_chain@OPENSSL_3.0.0socket_timeoutBIO_push@OPENSSL_3.0.0ecparam_mainOSSL_CMP_CTX_server_perform@OPENSSL_3.0.0X509_REQ_get_subject_name@OPENSSL_3.0.0s_client_optionsconfigutl_mainPEM_read_bio@OPENSSL_3.0.0X509_ALGOR_set0@OPENSSL_3.0.0EVP_PKEY_derive@OPENSSL_3.0.0X509_get_subject_name@OPENSSL_3.0.0SSL_SESSION_get_id@OPENSSL_3.0.0OSSL_CMP_ITAV_new_rootCaKeyUpdate@OPENSSL_3.2.0X509_get0_extensions@OPENSSL_3.0.0stderr@GLIBC_2.4BIO_sock_should_retry@OPENSSL_3.0.0OSSL_CMP_CTX_build_cert_chain@OPENSSL_3.0.0X509_email_free@OPENSSL_3.0.0X509V3_EXT_CRL_add_nconf@OPENSSL_3.0.0SSL_CTX_set_client_CA_list@OPENSSL_3.0.0ENGINE_get_pkey_asn1_meth_str@OPENSSL_3.0.0init_gen_strOSSL_STORE_SEARCH_by_name@OPENSSL_3.0.0OSSL_CMP_CTX_snprint_PKIStatus@OPENSSL_3.0.0storeutl_optionsSSL_CTX_use_psk_identity_hint@OPENSSL_3.0.0TS_RESP_set_status_info@OPENSSL_3.0.0BIO_ssl_shutdown@OPENSSL_3.0.0opt_uintmaxASN1_ENUMERATED_free@OPENSSL_3.0.0SSL_CIPHER_get_name@OPENSSL_3.0.0ssl_ctx_security_debughttp_server_send_asn1_respASN1_item_d2i_bio@OPENSSL_3.0.0OBJ_nid2sn@OPENSSL_3.0.0SRP_VBASE_new@OPENSSL_3.0.0EVP_sha1@OPENSSL_3.0.0RAND_load_file@OPENSSL_3.0.0OSSL_ENCODER_get0_description@OPENSSL_3.0.0BIO_gets@OPENSSL_3.0.0UI_method_get_writer@OPENSSL_3.0.0SCT_print@OPENSSL_3.0.0EVP_RAND_get_state@OPENSSL_3.0.0EVP_KEM_gettable_ctx_params@OPENSSL_3.0.0OSSL_CMP_CTX_push1_subjectAltName@OPENSSL_3.0.0OSSL_PARAM_BLD_to_param@OPENSSL_3.0.0EVP_CIPHER_CTX_free@OPENSSL_3.0.0EVP_PKEY_encrypt@OPENSSL_3.0.0SSL_get0_next_proto_negotiated@OPENSSL_3.0.0s_client_mainBIO_write@OPENSSL_3.0.0crl_mainfileno@GLIBC_2.4rsautl_optionsSSL_CTX_set_default_verify_dir@OPENSSL_3.0.0RAND_get0_primary@OPENSSL_3.0.0set_cert_key_stuffOCSP_SINGLERESP_add1_ext_i2d@OPENSSL_3.0.0ERR_clear_last_mark@OPENSSL_3.0.0OSSL_PROVIDER_get_params@OPENSSL_3.0.0mac_mainEVP_PKEY_get_bits@OPENSSL_3.0.0collect_namesOSSL_STORE_INFO_get1_PARAMS@OPENSSL_3.0.0PEM_write_bio@OPENSSL_3.0.0X509_PURPOSE_get_by_sname@OPENSSL_3.0.0OPENSSL_hexchar2int@OPENSSL_3.0.0OSSL_STORE_INFO_type_string@OPENSSL_3.0.0OSSL_CMP_MSG_http_perform@OPENSSL_3.0.0d2i_X509_CRL_bio@OPENSSL_3.0.0ossl_cmp_mock_srv_set1_caPubsOutTS_REQ_set_nonce@OPENSSL_3.0.0app_conf_try_numberSSL_shutdown@OPENSSL_3.0.0fork@GLIBC_2.4d2i_OCSP_RESPONSE@OPENSSL_3.0.0opt_appnameasn1parse_mainBIO_get_callback_arg@OPENSSL_3.0.0OCSP_request_onereq_count@OPENSSL_3.0.0OSSL_STORE_LOADER_set_open@OPENSSL_3.0.0PKCS7_to_TS_TST_INFO@OPENSSL_3.0.0OSSL_PARAM_modified@OPENSSL_3.0.0BN_options@OPENSSL_3.0.0OSSL_CRMF_CERTID_get0_issuer@OPENSSL_3.0.0ASN1_TIME_set_string_X509@OPENSSL_3.0.0EVP_MD_CTX_new@OPENSSL_3.0.0info_optionsEVP_PKEY_get_utf8_string_param@OPENSSL_3.0.0EVP_PKEY_print_private@OPENSSL_3.0.0OSSL_CMP_CTX_set1_untrusted@OPENSSL_3.0.0CMS_add1_ReceiptRequest@OPENSSL_3.0.0EVP_PKEY_CTX_set_params@OPENSSL_3.0.0pkeyutl_optionsBN_num_bits@OPENSSL_3.0.0ASN1_item_d2i@OPENSSL_3.0.0asn1parse_optionsset_ext_copyBIO_read_ex@OPENSSL_3.0.0RAND_status@OPENSSL_3.0.0i2d_OCSP_RESPONSE@OPENSSL_3.0.0X509_STORE_new@OPENSSL_3.0.0ASYNC_is_capable@OPENSSL_3.0.0access@GLIBC_2.4OCSP_request_sign@OPENSSL_3.0.0EVP_SKEY_get0_key_id@OPENSSL_3.5.0X509_VERIFY_PARAM_set_time@OPENSSL_3.0.0TS_REQ_set_version@OPENSSL_3.0.0PKCS7_decrypt@OPENSSL_3.0.0isatty@GLIBC_2.4SSL_CONF_CTX_finish@OPENSSL_3.0.0EVP_PKCS82PKEY@OPENSSL_3.0.0SSL_get_certificate@OPENSSL_3.0.0UI_free@OPENSSL_3.0.0d2i_PKCS7_bio@OPENSSL_3.0.0PBMAC1_get1_pbkdf2_param@OPENSSL_3.4.0app_tmintervalBIO_f_ssl@OPENSSL_3.0.0BIO_read@OPENSSL_3.0.0X509_ALGOR_free@OPENSSL_3.0.0OSSL_CMP_exec_RR_ses@OPENSSL_3.0.0ssl_print_sigalgsPKCS5_pbe2_set_iv@OPENSSL_3.0.0BIO_ADDR_rawport@OPENSSL_3.0.0ossl_cmp_mock_srv_set1_certOutEVP_PKEY_CTX_new_from_name@OPENSSL_3.0.0s_server_optionsEVP_SKEYMGMT_do_all_provided@OPENSSL_3.5.0tls13_aes256gcmsha384_idOSSL_STORE_do_all_loaders@OPENSSL_3.0.0OPENSSL_strcasecmp@OPENSSL_3.0.3X509_NAME_get_entry@OPENSSL_3.0.0PKCS12_SAFEBAG_get1_cert@OPENSSL_3.0.0genpkey_mainEVP_PKEY_CTX_set_rsa_padding@OPENSSL_3.0.0OBJ_nid2obj@OPENSSL_3.0.0ossl_cmp_mock_srv_set_statusInfoSSL_CTX_add_client_custom_ext@OPENSSL_3.0.0ossl_cmp_mock_srv_set_pollCountOPENSSL_sk_deep_copy@OPENSSL_3.0.0X509_policy_tree_get0_policies@OPENSSL_3.0.0SSL_CTX_set_ciphersuites@OPENSSL_3.0.0ASN1_UTCTIME_new@OPENSSL_3.0.0ssl_print_groupsOPENSSL_uni2asc@OPENSSL_3.0.0EVP_MAC_gettable_ctx_params@OPENSSL_3.0.0next_itemsetup_engine_methodsSSL_CONF_CTX_set_flags@OPENSSL_3.0.0BIO_new_fd@OPENSSL_3.0.0opt_initopt_ulongEVP_KDF_settable_ctx_params@OPENSSL_3.0.0TS_REQ_new@OPENSSL_3.0.0config_ctxec_optionsdhparam_optionsOSSL_CMP_MSG_it@OPENSSL_3.0.0PEM_read_bio_PKCS8_PRIV_KEY_INFO@OPENSSL_3.0.0SCRYPT_PARAMS_free@OPENSSL_3.0.0BIO_new_socket@OPENSSL_3.0.0NCONF_new@OPENSSL_3.0.0dgst_optionsOSSL_PROVIDER_add_conf_parameter@OPENSSL_3.5.0EVP_PKEY_decapsulate_init@OPENSSL_3.0.0X509V3_set_issuer_pkey@OPENSSL_3.0.0d2i_OCSP_REQUEST@OPENSSL_3.0.0ASN1_TIME_new@OPENSSL_3.0.0strstr@GLIBC_2.4X509_VERIFY_PARAM_set1_email@OPENSSL_3.0.0opt_nextOSSL_STORE_INFO_new_PUBKEY@OPENSSL_3.0.0PBE2PARAM_it@OPENSSL_3.0.0ourpeerX509_STORE_CTX_get_obj_by_subject@OPENSSL_3.0.0BN_GENCB_new@OPENSSL_3.0.0X509_LOOKUP_file@OPENSSL_3.0.0BIO_ADDR_new@OPENSSL_3.0.0SSL_CTX_set_default_verify_file@OPENSSL_3.0.0SSL_is_init_finished@OPENSSL_3.0.0opt_printf_stderrENGINE_get_DSA@OPENSSL_3.0.0ENGINE_register_all_complete@OPENSSL_3.0.0SSL_SESSION_set_cipher@OPENSSL_3.0.0OSSL_STORE_INFO_get0_PUBKEY@OPENSSL_3.0.0PEM_write_bio_X509@OPENSSL_3.0.0i2d_PKCS7_bio_stream@OPENSSL_3.0.0EVP_SKEYMGMT_names_do_all@OPENSSL_3.5.0EVP_CIPHER_CTX_set_padding@OPENSSL_3.0.0BN_hex2bn@OPENSSL_3.0.0OSSL_PARAM_get_int64@OPENSSL_3.0.0X509_NAME_add_entry_by_NID@OPENSSL_3.0.0i2d_RSAPublicKey_bio@OPENSSL_3.0.0EC_curve_nid2nist@OPENSSL_3.0.0EVP_CIPHER_get_key_length@OPENSSL_3.0.0EVP_PKEY_CTX_set1_id@OPENSSL_3.0.0PKCS7_print_ctx@OPENSSL_3.0.0OSSL_CMP_snprint_PKIStatusInfo@OPENSSL_3.0.0passwd_mainOSSL_CMP_CTX_push0_policy@OPENSSL_3.0.0X509_get_ext_d2i@OPENSSL_3.0.0OSSL_CMP_ITAV_new_caCerts@OPENSSL_3.2.0set_crl_lastupdateEVP_DigestVerifyFinal@OPENSSL_3.0.0OCSP_REQUEST_print@OPENSSL_3.0.0BIO_ADDRINFO_free@OPENSSL_3.0.0get_ui_methodPKCS7_add_certificate@OPENSSL_3.0.0OSSL_PARAM_BLD_free@OPENSSL_3.0.0PKCS12_SAFEBAG_free@OPENSSL_3.0.0BN_bn2bin@OPENSSL_3.0.0cms_mainX509_verify@OPENSSL_3.0.0OSSL_PARAM_construct_octet_string@OPENSSL_3.0.0EVP_KEYMGMT_fetch@OPENSSL_3.0.0ASN1_tag2str@OPENSSL_3.0.0__isoc23_strtoul@GLIBC_2.38SSL_CTX_get0_ctlog_store@OPENSSL_3.0.0OBJ_create@OPENSSL_3.0.0ASN1_TIME_compare@OPENSSL_3.0.0BN_set_word@OPENSSL_3.0.0EVP_PKEY_keygen@OPENSSL_3.0.0EVP_PKEY_CTX_set_dh_nid@OPENSSL_3.0.0X509_alias_get0@OPENSSL_3.0.0SSL_CTX_set_psk_use_session_callback@OPENSSL_3.0.0BIO_f_md@OPENSSL_3.0.0PEM_read_bio_X509_CRL@OPENSSL_3.0.0OCSP_request_onereq_get0@OPENSSL_3.0.0X509_STORE_CTX_get_explicit_policy@OPENSSL_3.0.0BUF_MEM_new@OPENSSL_3.0.0OSSL_DECODER_names_do_all@OPENSSL_3.0.0PKCS7_get0_signers@OPENSSL_3.0.0ASN1_OCTET_STRING_cmp@OPENSSL_3.0.0X509_CRL_set1_lastUpdate@OPENSSL_3.0.0opt_longget_cipher_from_engineTS_REQ_print_bio@OPENSSL_3.0.0OPT_MORE_STRGENERAL_NAME_print@OPENSSL_3.0.0OSSL_STORE_register_loader@OPENSSL_3.0.0OSSL_CMP_ATAV_new_rsaKeyLen@OPENSSL_3.4.0NCONF_get_section_names@OPENSSL_3.0.0X509_digest@OPENSSL_3.0.0BN_new@OPENSSL_3.0.0wrap_password_callbackX509_NAME_get_index_by_NID@OPENSSL_3.0.0i2d_OCSP_REQUEST@OPENSSL_3.0.0TS_CONF_set_ordering@OPENSSL_3.0.0SSL_CTX_load_verify_store@OPENSSL_3.0.0EVP_PBE_find@OPENSSL_3.0.0ASN1_GENERALIZEDTIME_new@OPENSSL_3.0.0EVP_KEYMGMT_get0_provider@OPENSSL_3.0.0ASN1_INTEGER_to_BN@OPENSSL_3.0.0SSL_group_to_name@OPENSSL_3.0.0X509_NAME_print_ex_fp@OPENSSL_3.0.0EVP_MAC_up_ref@OPENSSL_3.0.0CRYPTO_memdup@OPENSSL_3.0.0opt_cipherOPENSSL_LH_strhash@OPENSSL_3.0.0EVP_CIPHER_CTX_set_key_length@OPENSSL_3.0.0SSL_CTX_set_cert_cb@OPENSSL_3.0.0EVP_KDF_do_all_provided@OPENSSL_3.0.0EVP_sha512@OPENSSL_3.0.0EVP_MAC_update@OPENSSL_3.0.0get_passwdBIO_dump_indent@OPENSSL_3.0.0ec_mainOPENSSL_sk_value@OPENSSL_3.0.0X509_REQ_new@OPENSSL_3.0.0store_setup_crl_downloadASN1_parse_dump@OPENSSL_3.0.0ASN1_ENUMERATED_set@OPENSSL_3.0.0X509_VERIFY_PARAM_get_flags@OPENSSL_3.0.0do_ssl_shutdownopt_cipher_anyapp_load_config_modulesOSSL_CMP_CTX_set1_no_proxy@OPENSSL_3.0.0EVP_MAC_CTX_new@OPENSSL_3.0.0OSSL_CMP_CTX_set1_expected_sender@OPENSSL_3.0.0OSSL_CMP_SRV_CTX_set_accept_raverified@OPENSSL_3.0.0OCSP_resp_find_status@OPENSSL_3.0.0d2i_SSL_SESSION@OPENSSL_3.0.0setsockopt@GLIBC_2.4X509_REQ_free@OPENSSL_3.0.0bio_open_default_quietNCONF_new_ex@OPENSSL_3.0.0PEM_write_bio_NETSCAPE_CERT_SEQUENCE@OPENSSL_3.0.0OSSL_DECODER_from_bio@OPENSSL_3.0.0PBKDF2PARAM_it@OPENSSL_3.0.0X509_CRL_add0_revoked@OPENSSL_3.0.0X509_VERIFY_PARAM_get0_host@OPENSSL_3.0.0select@GLIBC_2.4OSSL_PROVIDER_load@OPENSSL_3.0.0ERR_get_error@OPENSSL_3.0.0EVP_KEM_names_do_all@OPENSSL_3.0.0EVP_md5@OPENSSL_3.0.0OSSL_STORE_LOADER_get0_provider@OPENSSL_3.0.0ASN1_TIME_diff@OPENSSL_3.0.0X509_get_default_cert_dir@OPENSSL_3.0.0EVP_PKEY_fromdata@OPENSSL_3.0.0BIO_puts@OPENSSL_3.0.0CMS_RecipientInfo_type@OPENSSL_3.0.0CRYPTO_realloc@OPENSSL_3.0.0ASN1_item_i2d_bio@OPENSSL_3.0.0shutdown@GLIBC_2.4PEM_write_bio_RSAPublicKey@OPENSSL_3.0.0CMS_compress@OPENSSL_3.0.0EVP_MAC_do_all_provided@OPENSSL_3.0.0print_verify_detailERR_clear_error@OPENSSL_3.0.0symlink@GLIBC_2.4ossl_cmp_mock_srv_set1_refCertSSL_get_early_data_status@OPENSSL_3.0.0TXT_DB_write@OPENSSL_3.0.0load_pubkeyOPENSSL_sk_find@OPENSSL_3.0.0raise@GLIBC_2.4OSSL_CMP_HDR_get0_geninfo_ITAVs@OPENSSL_3.3.0OCSP_RESPONSE_new@OPENSSL_3.0.0OSSL_CMP_HDR_get0_transactionID@OPENSSL_3.0.0OSSL_CMP_CTX_set1_srvCert@OPENSSL_3.0.0__ctype_b_loc@GLIBC_2.4SSL_CTX_get0_certificate@OPENSSL_3.0.0OSSL_HTTP_get@OPENSSL_3.0.0ASN1_INTEGER_cmp@OPENSSL_3.0.0__bss_start__X509_REVOKED_set_revocationDate@OPENSSL_3.0.0NCONF_free@OPENSSL_3.0.0SSL_get_rbio@OPENSSL_3.0.0spawn_loopOSSL_CRMF_MSG_get0_regCtrl_oldCertID@OPENSSL_3.0.0__aeabi_idivmodSSL_CTX_use_certificate_file@OPENSSL_3.0.0OSSL_CMP_CTX_set1_transactionID@OPENSSL_3.0.0SSL_CTX_sess_set_get_cb@OPENSSL_3.0.0OSSL_PARAM_construct_int@OPENSSL_3.0.0ENGINE_get_pkey_meths@OPENSSL_3.0.0OSSL_CMP_ATAV_push1@OPENSSL_3.4.0SSL_CTX_set_tlsext_use_srtp@OPENSSL_3.0.0OSSL_CMP_MSG_write@OPENSSL_3.0.0BIO_get_retry_reason@OPENSSL_3.0.0i2d_TS_REQ_bio@OPENSSL_3.0.0SSL_stream_conclude@OPENSSL_3.2.0ciphers_optionsBN_free@OPENSSL_3.0.0EVP_PKEY_keygen_init@OPENSSL_3.0.0OSSL_STORE_SEARCH_by_issuer_serial@OPENSSL_3.0.0x509_optionsX509_PURPOSE_get0_name@OPENSSL_3.0.0opt_randhelp_options__data_startTS_CONF_set_def_policy@OPENSSL_3.0.0ctx_set_ctlog_list_fileOBJ_obj2nid@OPENSSL_3.0.0EVP_KEYMGMT_names_do_all@OPENSSL_3.0.0EVP_SIGNATURE_fetch@OPENSSL_3.0.0SSL_CTX_set_default_ctlog_list_file@OPENSSL_3.0.0speed_mainCMS_decrypt@OPENSSL_3.0.0sysconf@GLIBC_2.4OPENSSL_DIR_read@OPENSSL_3.0.0X509_STORE_CTX_get1_chain@OPENSSL_3.0.0SSL_CTX_use_certificate@OPENSSL_3.0.0OCSP_BASICRESP_new@OPENSSL_3.0.0EC_get_builtin_curves@OPENSSL_3.0.0X509_VERIFY_PARAM_new@OPENSSL_3.0.0EVP_PKEY_CTX_set1_rsa_keygen_pubexp@OPENSSL_3.0.0OCSP_request_add1_nonce@OPENSSL_3.0.0SSL_CTX_set0_CA_list@OPENSSL_3.0.0OSSL_CMP_HDR_get0_recipNonce@OPENSSL_3.0.0TS_RESP_CTX_set_signer_digest@OPENSSL_3.0.0SSL_get_session@OPENSSL_3.0.0calculate_columnsOPENSSL_buf2hexstr@OPENSSL_3.0.0ASN1_item_unpack@OPENSSL_3.0.0SSL_get_shared_ciphers@OPENSSL_3.0.0ASN1_PCTX_set_str_flags@OPENSSL_3.0.0OBJ_create_objects@OPENSSL_3.0.0skeyutl_mainEVP_KEYMGMT_get0_name@OPENSSL_3.0.0init_engineX509_CRL_load_http@OPENSSL_3.0.0setup_ui_methodcleanseEVP_MAC_get0_name@OPENSSL_3.0.0s2i_ASN1_INTEGER@OPENSSL_3.0.0SSL_CTX_set_security_callback@OPENSSL_3.0.0OSSL_STORE_error@OPENSSL_3.0.0errstr_optionsstrncat@GLIBC_2.4X509_ocspid_print@OPENSSL_3.0.0X509_PURPOSE_get0@OPENSSL_3.0.0SSL_get0_peername@OPENSSL_3.0.0OSSL_STORE_eof@OPENSSL_3.0.0TS_CONF_set_crypto_device@OPENSSL_3.0.0OSSL_CMP_ITAV_create@OPENSSL_3.0.0X509_issuer_name_hash@OPENSSL_3.0.0OSSL_DECODER_CTX_new_for_pkey@OPENSSL_3.0.0i2d_X509_CRL_bio@OPENSSL_3.0.0BIO_connect@OPENSSL_3.0.0SSL_get_current_expansion@OPENSSL_3.0.0OSSL_CMP_CTX_set_http_cb_arg@OPENSSL_3.0.0OCSP_check_nonce@OPENSSL_3.0.0PBEPARAM_it@OPENSSL_3.0.0OPENSSL_die@OPENSSL_3.0.0X509_CRL_set_issuer_name@OPENSSL_3.0.0X509_REQ_set_subject_name@OPENSSL_3.0.0SSL_connect@OPENSSL_3.0.0EVP_PKEY_CTX_set_rsa_keygen_primes@OPENSSL_3.0.0X509V3_parse_list@OPENSSL_3.0.0rehash_optionsSSL_CTX_enable_ct@OPENSSL_3.0.0CMS_RecipientInfo_get0_pkey_ctx@OPENSSL_3.0.0BIO_listen@OPENSSL_3.0.0ASN1_TYPE_get@OPENSSL_3.0.0OPENSSL_hexstr2buf@OPENSSL_3.0.0OCSP_RESPONSE_free@OPENSSL_3.0.0OSSL_PARAM_allocate_from_text@OPENSSL_3.0.0srp_optionsSSL_do_handshake@OPENSSL_3.0.0unpack_revinfoargs_excertEVP_DigestFinal@OPENSSL_3.0.0X509_set_subject_name@OPENSSL_3.0.0CMS_add0_recipient_password@OPENSSL_3.0.0PKCS7_new_ex@OPENSSL_3.0.0ssl_ctx_set_excertOSSL_CMP_CTX_push0_geninfo_ITAV@OPENSSL_3.0.0i2a_ASN1_INTEGER@OPENSSL_3.0.0ASYNC_WAIT_CTX_free@OPENSSL_3.0.0BN_add_word@OPENSSL_3.0.0app_paramgenX509_CRL_print@OPENSSL_3.0.0dup_bio_inEVP_KEYMGMT_settable_params@OPENSSL_3.0.0OSSL_DECODER_free@OPENSSL_3.0.0OPENSSL_LH_error@OPENSSL_3.0.0X509_get_serialNumber@OPENSSL_3.0.0SSL_CTX_new@OPENSSL_3.0.0PEM_write_bio_PKCS8@OPENSSL_3.0.0clear_freeOSSL_CMP_ITAV_get0_type@OPENSSL_3.0.0BN_CTX_free@OPENSSL_3.0.0OCSP_request_add0_id@OPENSSL_3.0.0RAND_poll@OPENSSL_3.0.0do_X509_signPKCS12_SAFEBAG_get_bag_nid@OPENSSL_3.0.0fgets@GLIBC_2.4X509V3_EXT_nconf@OPENSSL_3.0.0OSSL_STORE_INFO_get_type@OPENSSL_3.0.0OSSL_STORE_LOADER_is_a@OPENSSL_3.0.0X509_add1_ext_i2d@OPENSSL_3.0.0SSL_CTX_dane_enable@OPENSSL_3.0.0EVP_MD_CTX_set_pkey_ctx@OPENSSL_3.0.0TS_RESP_CTX_free@OPENSSL_3.0.0EVP_CIPHER_get0_name@OPENSSL_3.0.0print_param_typesEVP_KEYEXCH_fetch@OPENSSL_3.0.0OSSL_CMP_CTX_set1_serialNumber@OPENSSL_3.2.0OSSL_CMP_CTX_set1_recipient@OPENSSL_3.0.0OSSL_STORE_LOADER_set_error@OPENSSL_3.0.0dump_cert_textfputc@GLIBC_2.4EVP_KEM_get0_description@OPENSSL_3.0.0X509_STORE_CTX_set0_crls@OPENSSL_3.0.0OSSL_PARAM_locate_const@OPENSSL_3.0.0OSSL_CMP_ITAV_get0_crlStatusList@OPENSSL_3.4.0CMS_get1_certs@OPENSSL_3.0.0EVP_KEYMGMT_get0_description@OPENSSL_3.0.0info_mainBIO_test_flags@OPENSSL_3.0.0SSL_alert_type_string_long@OPENSSL_3.0.0__aeabi_ldiv0fwrite@GLIBC_2.4EVP_PKEY_set_utf8_string_param@OPENSSL_3.0.0OSSL_HTTP_proxy_connect@OPENSSL_3.0.0dup_bio_outX509_VERIFY_PARAM_set_flags@OPENSSL_3.0.0ASN1_generate_nconf@OPENSSL_3.0.0RAND_bytes@OPENSSL_3.0.0UI_add_user_data@OPENSSL_3.0.0ASN1_TIME_print_ex@OPENSSL_3.0.0X509_STORE_CTX_get0_policy_tree@OPENSSL_3.0.0OSSL_CMP_MSG_update_recipNonce@OPENSSL_3.0.9EVP_PKEY_copy_parameters@OPENSSL_3.0.0mac_optionsEVP_PKEY2PKCS8@OPENSSL_3.0.0X509_VERIFY_PARAM_clear_flags@OPENSSL_3.0.0SSL_has_matching_session_id@OPENSSL_3.0.0free_indexOPT_HELP_STREVP_CIPHER_CTX_ctrl@OPENSSL_3.0.0verify_callbackOSSL_PARAM_set_all_unmodified@OPENSSL_3.0.0ossl_cmp_mock_srv_set_checkAfterTimememcpy@GLIBC_2.4set_keylog_fileERR_pop_to_mark@OPENSSL_3.0.0OSSL_STORE_LOADER_set_close@OPENSSL_3.0.0X509_set_serialNumber@OPENSSL_3.0.0CRYPTO_calloc@OPENSSL_3.6.0ASN1_item_free@OPENSSL_3.0.0SSL_set_session_id_context@OPENSSL_3.0.0set_name_exEVP_CIPHER_gettable_ctx_params@OPENSSL_3.0.0BIO_ADDR_rawaddress@OPENSSL_3.0.0ASN1_OCTET_STRING_set@OPENSSL_3.0.0SSL_get0_peer_scts@OPENSSL_3.0.0d2i_TS_RESP_bio@OPENSSL_3.0.0X509_get0_serialNumber@OPENSSL_3.0.0EVP_PKEY_is_a@OPENSSL_3.0.0SSL_check_chain@OPENSSL_3.0.0__bss_startload_certstoreSSL_CTX_callback_ctrl@OPENSSL_3.0.0OSSL_STORE_INFO_free@OPENSSL_3.0.0EVP_KEM_settable_ctx_params@OPENSSL_3.0.0CMS_sign_ex@OPENSSL_3.0.0SSL_CTX_set_keylog_callback@OPENSSL_3.0.0OSSL_CMP_log_close@OPENSSL_3.0.0copy_extensionsPKCS7_verify@OPENSSL_3.0.0do_fpOSSL_STORE_INFO_get0_PKEY@OPENSSL_3.0.0CMS_decrypt_set1_key@OPENSSL_3.0.0EVP_KDF_free@OPENSSL_3.0.0EVP_PKEY_dup@OPENSSL_3.0.0X509_PURPOSE_get_count@OPENSSL_3.0.0RAND_write_file@OPENSSL_3.0.0rehash_mainOSSL_DECODER_settable_ctx_params@OPENSSL_3.0.0strlen@GLIBC_2.4OSSL_CMP_MSG_update_transactionID@OPENSSL_3.0.0NETSCAPE_SPKI_get_pubkey@OPENSSL_3.0.0CMS_ContentInfo_new_ex@OPENSSL_3.0.0SSL_is_server@OPENSSL_3.0.0TS_CONF_set_digests@OPENSSL_3.0.0ENGINE_load_public_key@OPENSSL_3.0.0OSSL_CMP_CRLSTATUS_get0@OPENSSL_3.4.0process_responderi2d_PUBKEY_bio@OPENSSL_3.0.0SSL_get_ciphers@OPENSSL_3.0.0BN_mod_exp@OPENSSL_3.0.0OSSL_CMP_CTX_set1_oldCert@OPENSSL_3.0.0OSSL_CMP_CTX_get0_untrusted@OPENSSL_3.0.0ssl_print_secure_renegotiation_notesX509_STORE_CTX_get_num_untrusted@OPENSSL_3.0.0X509_add_certs@OPENSSL_3.0.0EVP_KEM_is_a@OPENSSL_3.0.0SSL_CTX_set_srp_username_callback@OPENSSL_3.0.0EVP_MD_get_type@OPENSSL_3.0.0X509_STORE_CTX_free@OPENSSL_3.0.0X509_get_ext@OPENSSL_3.0.0BN_GENCB_free@OPENSSL_3.0.0BIO_vprintf@OPENSSL_3.0.0X509_get0_signature@OPENSSL_3.0.0SSL_get_event_timeout@OPENSSL_3.2.0OSSL_CMP_CTX_set1_extraCertsOut@OPENSSL_3.0.0X509_to_X509_REQ@OPENSSL_3.0.0BIO_f_prefix@OPENSSL_3.0.0EVP_DigestFinalXOF@OPENSSL_3.0.0X509_VERIFY_PARAM_set1@OPENSSL_3.0.0X509_CRL_sign_ctx@OPENSSL_3.0.0ssl_ctx_add_crlsUI_destroy_method@OPENSSL_3.0.0CMS_ReceiptRequest_free@OPENSSL_3.0.0PKCS12_SAFEBAG_get0_p8inf@OPENSSL_3.0.0fprintf@GLIBC_2.4OSSL_HTTP_adapt_proxy@OPENSSL_3.0.0fclose@GLIBC_2.4X509_STORE_set_default_paths_ex@OPENSSL_3.0.0ASN1_TYPE_free@OPENSSL_3.0.0EVP_CIPHER_up_ref@OPENSSL_3.0.0OSSL_CMP_SRV_CTX_get0_cmp_ctx@OPENSSL_3.0.0OSSL_CMP_PKISI_free@OPENSSL_3.0.0rsautl_mainOSSL_CMP_PKISI_new@OPENSSL_3.0.0opt_mdEVP_KDF_get0_provider@OPENSSL_3.0.0PKCS8_set0_pbe@OPENSSL_3.0.0OSSL_PARAM_construct_size_t@OPENSSL_3.0.0PKCS8_decrypt@OPENSSL_3.0.0X509_REQ_set_pubkey@OPENSSL_3.0.0SSL_get1_supported_ciphers@OPENSSL_3.0.0X509_EXTENSION_get_data@OPENSSL_3.0.0check_cert_attributesSSL_ct_is_enabled@OPENSSL_3.0.0TS_RESP_set_tst_info@OPENSSL_3.0.0progress_cbOPENSSL_strlcpy@OPENSSL_3.0.0app_RAND_loadOSSL_CMP_CTX_set0_trustedStore@OPENSSL_3.0.0EVP_RAND_get0_provider@OPENSSL_3.0.0EVP_EncryptFinal_ex@OPENSSL_3.0.0EVP_PKEY_check@OPENSSL_3.0.0X509_REQ_add1_attr_by_txt@OPENSSL_3.0.0PEM_write_bio_Parameters@OPENSSL_3.0.0ASN1_TIME_free@OPENSSL_3.0.0OSSL_trace_enabled@OPENSSL_3.0.0BIO_accept_ex@OPENSSL_3.0.0ossl_cmp_mock_srv_set1_crlOutSSL_CTX_set_recv_max_early_data@OPENSSL_3.0.0X509at_add1_attr@OPENSSL_3.0.0EVP_KDF_get0_name@OPENSSL_3.0.0BN_rand@OPENSSL_3.0.0OSSL_DECODER_get0_name@OPENSSL_3.0.0OSSL_CMP_CTX_set_certConf_cb_arg@OPENSSL_3.0.0ASN1_d2i_bio@OPENSSL_3.0.0ENGINE_get_RAND@OPENSSL_3.0.0OSSL_ENCODER_CTX_free@OPENSSL_3.0.0PEM_write_bio_X509_AUX@OPENSSL_3.0.0X509_STORE_add_crl@OPENSSL_3.0.0SSL_CONF_CTX_new@OPENSSL_3.0.0SSL_get_sigalgs@OPENSSL_3.0.0CMS_ContentInfo_print_ctx@OPENSSL_3.0.0SSL_CTX_set_stateless_cookie_generate_cb@OPENSSL_3.0.0BIO_ADDRINFO_protocol@OPENSSL_3.0.0OSSL_STORE_LOADER_set_load@OPENSSL_3.0.0CMS_get1_ReceiptRequest@OPENSSL_3.0.0X509_VERIFY_PARAM_set1_ip_asc@OPENSSL_3.0.0ENGINE_get_DH@OPENSSL_3.0.0SSL_get1_builtin_sigalgs@OPENSSL_3.4.0PKCS7_sign_add_signer@OPENSSL_3.0.0X509_REQ_get0_pubkey@OPENSSL_3.0.0X509_NAME_get_index_by_OBJ@OPENSSL_3.0.0EVP_KDF_is_a@OPENSSL_3.0.0PKCS12_mac_present@OPENSSL_3.0.0SSL_CTX_set_session_id_context@OPENSSL_3.0.0SSL_dane_tlsa_add@OPENSSL_3.0.0mlock@GLIBC_2.4SSL_CTX_config@OPENSSL_3.0.0EVP_PKEY_CTX_free@OPENSSL_3.0.0SSL_key_update@OPENSSL_3.0.0X509_gmtime_adj@OPENSSL_3.0.0stdout@GLIBC_2.4OSSL_CRMF_MSG_centralkeygen_requested@OPENSSL_3.5.0generate_stateless_cookie_callbackSSL_CTX_set_tlsext_max_fragment_length@OPENSSL_3.0.0__aeabi_uidivmodOCSP_copy_nonce@OPENSSL_3.0.0rotate_serialadd_oid_sectionOSSL_STORE_INFO_get1_CERT@OPENSSL_3.0.0OSSL_ENCODER_names_do_all@OPENSSL_3.0.0PEM_read_bio_Parameters_ex@OPENSSL_3.0.0release_engineCMS_add1_recipient@OPENSSL_3.0.0OCSP_resp_find@OPENSSL_3.0.0SSL_get_servername_type@OPENSSL_3.0.0SSL_CTX_check_private_key@OPENSSL_3.0.0ASN1_TYPE_set@OPENSSL_3.0.0set_dateoptX509_get0_notAfter@OPENSSL_3.0.0TS_REQ_to_TS_VERIFY_CTX@OPENSSL_3.0.0X509_PUBKEY_get0@OPENSSL_3.0.0BIO_pop@OPENSSL_3.0.0EVP_PKEY_decrypt_init@OPENSSL_3.0.0X509_STORE_set1_param@OPENSSL_3.0.0X509_STORE_load_store@OPENSSL_3.0.0EVP_RAND_CTX_get0_rand@OPENSSL_3.0.0app_get0_libctxPKCS12_SAFEBAG_get0_bag_obj@OPENSSL_3.0.0ERR_error_string_n@OPENSSL_3.0.0EVP_PKEY_decapsulate@OPENSSL_3.0.0EVP_PKEY_CTX_set_dh_paramgen_prime_len@OPENSSL_3.0.0OSSL_CMP_get1_caCerts@OPENSSL_3.2.0i2d_PrivateKey_bio@OPENSSL_3.0.0OSSL_CMP_ITAV_new0_certProfile@OPENSSL_3.3.0EVP_PKEY_verify_recover_init@OPENSSL_3.0.0SSL_SESSION_get0_peer@OPENSSL_3.0.0ASN1_TYPE_new@OPENSSL_3.0.0BIO_snprintf@OPENSSL_3.0.0EVP_KEM_get0_provider@OPENSSL_3.0.0msg_cbreport_server_acceptOSSL_CMP_ITAV_get0_certProfile@OPENSSL_3.3.0X509_REQ_add1_attr_by_NID@OPENSSL_3.0.0X509_STORE_CTX_get_current_cert@OPENSSL_3.0.0OSSL_CMP_STATUSINFO_new@OPENSSL_3.0.0X509_CRL_new_ex@OPENSSL_3.0.0EVP_PKEY_missing_parameters@OPENSSL_3.0.0_exit@GLIBC_2.4SSL_dane_set_flags@OPENSSL_3.0.0X509_get_pubkey@OPENSSL_3.0.0PKCS12_set_mac@OPENSSL_3.0.0fstat@GLIBC_2.33PKCS12_SAFEBAG_get0_type@OPENSSL_3.0.0SSL_COMP_get_name@OPENSSL_3.0.0SSL_CTX_set1_server_cert_type@OPENSSL_3.2.0ssl_print_tmp_keyBIO_new@OPENSSL_3.0.0X509_VERIFY_PARAM_set_depth@OPENSSL_3.0.0EVP_CIPHER_get_nid@OPENSSL_3.0.0SSL_dane_enable@OPENSSL_3.0.0OSSL_CMP_CTX_get_transfer_cb_arg@OPENSSL_3.0.0X509_STORE_load_file@OPENSSL_3.0.0PKCS7_encrypt_ex@OPENSSL_3.0.0OPENSSL_sk_set_thunks@OPENSSL_3.6.0SSL_set_options@OPENSSL_3.0.0ENGINE_set_default@OPENSSL_3.0.0EVP_des_ede3_cbc@OPENSSL_3.0.0opt_legacy_okaydhparam_mainOSSL_STORE_SEARCH_by_key_fingerprint@OPENSSL_3.0.0print_namesstrcmp@GLIBC_2.4d2i_PKCS8_bio@OPENSSL_3.0.0X509_CRL_sort@OPENSSL_3.0.0TS_REQ_set_cert_req@OPENSSL_3.0.0PKCS5_PBKDF2_HMAC@OPENSSL_3.0.0OPENSSL_asc2uni@OPENSSL_3.0.0s_server_mainOSSL_DECODER_fetch@OPENSSL_3.0.0CMS_final_digest@OPENSSL_3.2.0app_params_new_from_optsOSSL_ENCODER_CTX_get_num_encoders@OPENSSL_3.0.0OSSL_sleep@OPENSSL_3.2.0EVP_PKEY_asn1_find_str@OPENSSL_3.0.0EVP_RAND_get0_description@OPENSSL_3.0.0EVP_MD_fetch@OPENSSL_3.0.0SSL_CTX_set_quiet_shutdown@OPENSSL_3.0.0ENGINE_finish@OPENSSL_3.0.0X509_policy_tree_get0_user_policies@OPENSSL_3.0.0BIO_f_nbio_test@OPENSSL_3.0.0rand_serialget_dsaX509_get0_notBefore@OPENSSL_3.0.0EVP_PKEY_CTX_ctrl_str@OPENSSL_3.0.0OPENSSL_info@OPENSSL_3.0.0cert_matches_keytime@GLIBC_2.4EVP_sha256@OPENSSL_3.0.0OSSL_CMP_CTX_set1_senderNonce@OPENSSL_3.0.0PEM_write_bio_PKCS7_stream@OPENSSL_3.0.0OSSL_CMP_CTX_set1_p10CSR@OPENSSL_3.0.0OSSL_DECODER_get0_provider@OPENSSL_3.0.0EVP_CIPHER_settable_ctx_params@OPENSSL_3.0.0TS_TST_INFO_free@OPENSSL_3.0.0ASN1_GENERALIZEDTIME_set_string@OPENSSL_3.0.0list_optionsEVP_PKEY_get_size@OPENSSL_3.0.0__errno_location@GLIBC_2.4__aeabi_uidivSSL_get_key_update_type@OPENSSL_3.0.0app_initOBJ_cmp@OPENSSL_3.0.0EVP_MD_up_ref@OPENSSL_3.0.0ASN1_item_i2d_mem_bio@OPENSSL_3.0.0OCSP_cert_id_new@OPENSSL_3.0.0PKCS7_sign_ex@OPENSSL_3.0.0TS_RESP_new@OPENSSL_3.0.0CRYPTO_zalloc@OPENSSL_3.0.0OSSL_STORE_INFO_get1_PUBKEY@OPENSSL_3.0.0OSSL_STORE_LOADER_up_ref@OPENSSL_3.0.0app_conf_try_stringstrncpy@GLIBC_2.4UI_ctrl@OPENSSL_3.0.0EVP_PKEY_new@OPENSSL_3.0.0SSL_export_keying_material@OPENSSL_3.0.0X509V3_set_ctx@OPENSSL_3.0.0PEM_write_bio_PUBKEY@OPENSSL_3.0.0TS_RESP_print_bio@OPENSSL_3.0.0apps_ssl_info_callbackSSL_CONF_CTX_set_ssl_ctx@OPENSSL_3.0.0EVP_PKEY_set_octet_string_param@OPENSSL_3.0.0NCONF_load_bio@OPENSSL_3.0.0OSSL_STORE_expect@OPENSSL_3.0.0CRYPTO_clear_free@OPENSSL_3.0.0ASN1_STRING_free@OPENSSL_3.0.0PKCS12_verify_mac@OPENSSL_3.0.0OSSL_DECODER_is_a@OPENSSL_3.0.0reset_unknownSSL_use_certificate@OPENSSL_3.0.0get_sock_info_addressfflush@GLIBC_2.4X509_STORE_CTX_get0_parent_ctx@OPENSSL_3.0.0TS_CONF_set_accuracy@OPENSSL_3.0.0s_time_optionsCMS_encrypt_ex@OPENSSL_3.0.0BIO_ADDR_hostname_string@OPENSSL_3.0.0EVP_DigestSignInit_ex@OPENSSL_3.0.0SSL_CTX_set_alpn_protos@OPENSSL_3.0.0OBJ_txt2nid@OPENSSL_3.0.0UI_method_set_opener@OPENSSL_3.0.0SSL_CTX_set_srp_username@OPENSSL_3.0.0X509_issuer_name_hash_old@OPENSSL_3.0.0OSSL_ENCODER_up_ref@OPENSSL_3.0.0OSSL_STORE_find@OPENSSL_3.0.0OSSL_PARAM_get_uint64@OPENSSL_3.0.0memcmp@GLIBC_2.4OCSP_id_issuer_cmp@OPENSSL_3.0.0dump_certs_pkeys_bagOPENSSL_sk_pop_free@OPENSSL_3.0.0CRYPTO_memcmp@OPENSSL_3.0.0SSL_set1_server_cert_type@OPENSSL_3.2.0policies_printfipsinstall_mainmem_bio_to_filei2d_OSSL_CRMF_CERTTEMPLATE@OPENSSL_3.0.0OBJ_txt2obj@OPENSSL_3.0.0SSL_read_early_data@OPENSSL_3.0.0psk_keyapp_bail_outSSL_CTX_set_cookie_verify_cb@OPENSSL_3.0.0rand_optionsPEM_write_bio_PrivateKey_traditional@OPENSSL_3.0.0X509_NAME_free@OPENSSL_3.0.0SSL_CONF_CTX_free@OPENSSL_3.0.0EVP_MD_CTX_free@OPENSSL_3.0.0OSSL_CMP_SRV_CTX_init@OPENSSL_3.0.0opt_isdirSSL_certs_clear@OPENSSL_3.0.0BN_is_zero@OPENSSL_3.0.0OPENSSL_sk_shift@OPENSSL_3.0.0BIO_debug_callback_ex@OPENSSL_3.0.0EVP_DigestSignFinal@OPENSSL_3.0.0EVP_MD_get0_name@OPENSSL_3.0.0CMS_set1_eContentType@OPENSSL_3.0.0BIO_sock_info@OPENSSL_3.0.0opt_md_silentEVP_SKEY_import@OPENSSL_3.5.0i2d_X509_bio@OPENSSL_3.0.0SSL_get_selected_srtp_profile@OPENSSL_3.0.0SRP_check_known_gN_param@OPENSSL_3.0.0generate_cookie_callbackPKCS8_pkey_get0_attrs@OPENSSL_3.0.0smime_mainopt_flagecparam_optionsapp_http_post_asn1X509_time_adj@OPENSSL_3.0.0CMS_SignerInfo_get0_pkey_ctx@OPENSSL_3.0.0TLS_method@OPENSSL_3.0.0EVP_ASYM_CIPHER_get0_provider@OPENSSL_3.0.0X509V3_extensions_print@OPENSSL_3.0.0set_cert_stuffEVP_SIGNATURE_settable_ctx_params@OPENSSL_3.0.0EVP_PKEY_meth_get_count@OPENSSL_3.0.0EVP_CIPHER_get_mode@OPENSSL_3.0.0SSL_CTX_set_default_read_buffer_len@OPENSSL_3.0.0SSL_get_srp_N@OPENSSL_3.0.0opt_pairOSSL_PROVIDER_do_all@OPENSSL_3.0.0PEM_read_bio_X509@OPENSSL_3.0.0strrchr@GLIBC_2.4OPENSSL_cipher_name@OPENSSL_3.0.0ASYNC_init_thread@OPENSSL_3.0.0setup_verifyEVP_SKEY_get0_provider_name@OPENSSL_3.5.0EVP_KEYEXCH_free@OPENSSL_3.0.0PEM_write_bio_PKCS7@OPENSSL_3.0.0OSSL_CMP_MSG_get_bodytype@OPENSSL_3.0.0X509_NAME_hash_ex@OPENSSL_3.0.0bio_dump_callbackOCSP_response_status_str@OPENSSL_3.0.0log_set_verbosityopt_getprogNCONF_get_string@OPENSSL_3.0.0EVP_MAC_CTX_get_mac_size@OPENSSL_3.0.0kdf_mainenc_mainSSL_get_fd@OPENSSL_3.0.0OSSL_CMP_get1_certReqTemplate@OPENSSL_3.4.0X509_get_default_cert_dir_env@OPENSSL_3.0.0SCT_validation_status_string@OPENSSL_3.0.0EVP_SIGNATURE_is_a@OPENSSL_3.0.0alarm@GLIBC_2.4ASN1_STRING_get0_data@OPENSSL_3.0.0EVP_SKEY_generate@OPENSSL_3.5.0SSL_SESSION_free@OPENSSL_3.0.0opt_intmaxOBJ_nid2ln@OPENSSL_3.0.0ASN1_STRING_set_default_mask_asc@OPENSSL_3.0.0SSL_CTX_set_client_cert_engine@OPENSSL_3.0.0SSL_SESSION_get0_cipher@OPENSSL_3.0.0SSL_trace@OPENSSL_3.0.0EVP_SIGNATURE_names_do_all@OPENSSL_3.0.0EVP_MAC_init@OPENSSL_3.0.0X509_CRL_get_ext_d2i@OPENSSL_3.0.0trace_log_messageinit_clientCMS_add0_recipient_key@OPENSSL_3.0.0CRYPTO_malloc@OPENSSL_3.0.0X509_dup@OPENSSL_3.0.0EVP_PKEY_up_ref@OPENSSL_3.0.0EVP_DigestVerifyInit_ex@OPENSSL_3.0.0OSSL_CMP_ITAV_free@OPENSSL_3.0.0ASN1_STRING_length@OPENSSL_3.0.0openlog@GLIBC_2.4OCSP_REQUEST_it@OPENSSL_3.0.0SSL_CTX_get_cert_store@OPENSSL_3.0.0SSL_get0_dane_authority@OPENSSL_3.0.0OCSP_check_validity@OPENSSL_3.0.0BN_bn2hex@OPENSSL_3.0.0OSSL_STORE_close@OPENSSL_3.0.0OSSL_DECODER_get0_properties@OPENSSL_3.0.0rand_mainOSSL_CMP_ATAV_new_algId@OPENSSL_3.4.0OSSL_CMP_CTX_set_option@OPENSSL_3.0.0EVP_CIPHER_get_iv_length@OPENSSL_3.0.0SSL_accept@OPENSSL_3.0.0PKCS12_unpack_p7data@OPENSSL_3.0.0EVP_CIPHER_free@OPENSSL_3.0.0OSSL_STORE_attach@OPENSSL_3.0.0X509_chain_up_ref@OPENSSL_3.0.0OSSL_ENCODER_CTX_set_cipher@OPENSSL_3.0.0opt_path_endAPP_HTTP_TLS_INFO_freeEVP_SIGNATURE_get0_provider@OPENSSL_3.0.0getenv@GLIBC_2.4EVP_SKEY_free@OPENSSL_3.5.0SSL_get_peer_signature_type_nid@OPENSSL_3.0.0EVP_CIPHER_fetch@OPENSSL_3.0.0X509_LOOKUP_hash_dir@OPENSSL_3.0.0i2d_PKCS12_bio@OPENSSL_3.0.0X509_ATTRIBUTE_count@OPENSSL_3.0.0__isoc23_strtoimax@GLIBC_2.38OPT_SECTION_STRdup@GLIBC_2.4EVP_PKEY_public_check@OPENSSL_3.0.0X509_ATTRIBUTE_create@OPENSSL_3.0.0ossl_cmp_mock_srv_freeTS_MSG_IMPRINT_set_algo@OPENSSL_3.0.0set_cert_exSSL_CTX_set_options@OPENSSL_3.0.0OPENSSL_sk_new_null@OPENSSL_3.0.0__gmon_start__BIO_parse_hostserv@OPENSSL_3.0.0ASN1_STRING_print_ex@OPENSSL_3.0.0ASN1_PCTX_new@OPENSSL_3.0.0dup_bio_errSSL_set1_client_cert_type@OPENSSL_3.2.0X509_REVOKED_add1_ext_i2d@OPENSSL_3.0.0rename@GLIBC_2.4BIO_set_callback_ex@OPENSSL_3.0.0OSSL_STORE_SEARCH_by_alias@OPENSSL_3.0.0BIO_number_read@OPENSSL_3.0.0PEM_read_bio_Parameters@OPENSSL_3.0.0OPENSSL_sk_sort@OPENSSL_3.0.0UI_add_input_string@OPENSSL_3.0.0ENGINE_free@OPENSSL_3.0.0app_load_config_verboseX509_REQ_verify_ex@OPENSSL_3.0.0OSSL_CMP_SRV_CTX_new@OPENSSL_3.0.0EVP_DigestInit@OPENSSL_3.0.0SSL_CTX_set_cookie_generate_cb@OPENSSL_3.0.0load_keyparamsNCONF_get_section@OPENSSL_3.0.0PKCS7_SIGNED_new@OPENSSL_3.0.0EVP_DigestUpdate@OPENSSL_3.0.0SSL_CTX_use_serverinfo_file@OPENSSL_3.0.0app_load_modulesstrchr@GLIBC_2.4SSL_write@OPENSSL_3.0.0CRYPTO_strdup@OPENSSL_3.0.0EVP_PKEY_derive_init@OPENSSL_3.0.0TS_CONF_get_tsa_section@OPENSSL_3.0.0OpenSSL_version@OPENSSL_3.0.0OSSL_CMP_CTX_set1_serverPath@OPENSSL_3.0.0OSSL_CMP_CTX_free@OPENSSL_3.0.0EVP_CIPHER_CTX_get_block_size@OPENSSL_3.0.0EVP_PKEY_CTX_set_dh_paramgen_generator@OPENSSL_3.0.0CRYPTO_strndup@OPENSSL_3.0.0X509_check_purpose@OPENSSL_3.0.0SSL_CTX_set_alpn_select_cb@OPENSSL_3.0.0EVP_MD_gettable_ctx_params@OPENSSL_3.0.0TS_MSG_IMPRINT_free@OPENSSL_3.0.0X509_VERIFY_PARAM_set1_host@OPENSSL_3.0.0X509_REQ_get_extensions@OPENSSL_3.0.0EVP_SKEYMGMT_get0_provider@OPENSSL_3.5.0OSSL_CMP_CTX_get_http_cb_arg@OPENSSL_3.0.0lstat@GLIBC_2.33ENGINE_get_RSA@OPENSSL_3.0.0ASN1_TIME_print@OPENSSL_3.0.0X509_check_host@OPENSSL_3.0.0ENGINE_get_cipher_engine@OPENSSL_3.0.0OSSL_STORE_LOADER_free@OPENSSL_3.0.0EVP_KEM_fetch@OPENSSL_3.0.0dump_certs_keys_p12EVP_KDF_CTX_new@OPENSSL_3.0.0FMT_istextOSSL_CMP_CTX_get_option@OPENSSL_3.0.0EVP_PKEY_CTX_new_id@OPENSSL_3.0.0OSSL_ENCODER_is_a@OPENSSL_3.0.0EVP_SKEYMGMT_get0_name@OPENSSL_3.5.0pkcs8_mainX509_getm_notBefore@OPENSSL_3.0.0TS_MSG_IMPRINT_set_msg@OPENSSL_3.0.0OCSP_onereq_get0_id@OPENSSL_3.0.0pipe@GLIBC_2.4ASN1_item_i2d@OPENSSL_3.0.0ASN1_STRING_cmp@OPENSSL_3.0.0UI_get_string_type@OPENSSL_3.0.0ENGINE_get_digests@OPENSSL_3.0.0SSL_CTX_load_verify_file@OPENSSL_3.0.0crl_optionsEVP_PKEY_CTX_get_app_data@OPENSSL_3.0.0TS_STATUS_INFO_set_status@OPENSSL_3.0.0X509_NAME_ENTRY_get_data@OPENSSL_3.0.0BIO_int_ctrl@OPENSSL_3.0.0OSSL_CMP_CTX_get1_caPubs@OPENSSL_3.0.0OSSL_CMP_ATAVS_free@OPENSSL_3.4.0EVP_KEYMGMT_gen_settable_params@OPENSSL_3.0.0EVP_PKEY_verify_init@OPENSSL_3.0.0ASYNC_start_job@OPENSSL_3.0.0__isoc23_strtol@GLIBC_2.38app_provider_loadSSL_get0_peer_certificate@OPENSSL_3.0.0ASN1_INTEGER_new@OPENSSL_3.0.0BIO_printf@OPENSSL_3.0.0SSL_CTX_set1_client_cert_type@OPENSSL_3.2.0X509_REQ_set0_distinguishing_id@OPENSSL_3.0.0OSSL_CMP_ATAV_get0_type@OPENSSL_3.4.0.symtab.strtab.shstrtab.interp.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.note.ABI-tag.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributes.debug_aranges.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_line_strTT'pp*#oh,h,2- X_X_Pk5މ=oTTj Joaa Y ccPb B`c`c5k fTPq@@`w } \.p       P  $$ $ g r ;0r "pr 3s `xs 0t vt 'u h)08v n40w x @! v !˜D