ELF(:44 (%$p444  TTTЃЃHHH  ؋؛؛ QtdRtdHHH/lib/ld-linux-armhf.so.3ku5>zG(?Eb*@:9txM\LeWS#w]Y;mXfd6BDH ^-<AcR,ZTJOh}" +$I 2g=13N [aCjvi)~k|s`Kop{n_ylr %'/.&VFPU4807Q!q  ,d;wlsskیDBlZ(+ ^.")"aJ9a||m$p.nt[(Qo(#.USu \ }{/`HUC9LM=4gegZ|`uC.(vFE >ksBN=;!g=5]f6M8" " l" 24" 0" #ȓ" __sendmsg64syslogerror_message_countstrcpygetpagesize__clock_gettime64pthread_attr_setstacksize__nss_hosts_lookup2__nss_database_getepoll_ctlputcargp_errorchmodprogram_invocation_short_namefopen64getservbyport_rperrorgetdtablesizesetsid__fstat64_time64__libc_fatal__strndupchdirsetgidpthread_oncemsync__resolv_context_get__assert_failreaddir64__nss_passwd_lookup2pthread_rwlock_rdlock__isoc23_fscanfaccept4__h_errno_location__merge_grpargp_helpstrdupget_current_dir_name_res_hconfclosedir_obstack_newchunkgetpwnam_r__getdelimbindsetuidstrrchrputcharpthread_rwlock_trywrlockunlinkmunmapferrorfflushmemmovemmap64setgroups__nss_lookuppollsocketforkstrlenpthread_cond_initgetservbyname_r__nss_services_lookup2argp_program_version_hook__ctype_b_locreadepoll_waitstrchrnulposix_fallocate64inotify_add_watch__resolv_context_putstrnlensendpthread_attr_initsetresgid__libc_scratch_buffer_grow_preserve__isoc23_strtolargp_parsepthread_createpthread_cond_signaldup2getpidinotify_init1__libc_alloca_cutoff__pthread_cond_timedwait64readlinkstdoutpthread_mutex_lockrealloc_exitgetpwnamstrftimestrcasecmpmkostemp64setresuid__nss_disable_nscd__nss_hashconfstrmalloc__libc_start_main__stat64_time64__nss_lookup_function__libc_scratch_buffer_growpthread_rwlock_unlockpthread_rwlock_wrlockexecv__time64stderr__localtime64_rtextdomain__copy_grpinotify_rm_watchlistenepoll_createstrncasecmpopenlog__clock_getres64inet_ntopvsnprintfpthread_rwlock_init__res_init__cxa_finalizesetlocalegetgrgid_rfgets_unlockedgetgidstrerrorkill__nss_next2pthread_mutex_initgetenvcallocmemcmpfclosememset__nss_group_lookup2__isoc23_strtoulpthread_attr_setdetachstategetgrouplistvfprintf__nss_hostname_digits_dotsfputsconnectpthread_condattr_setclockpwrite64program_invocation_namepthread_mutex_unlock_libc_intl_domainnameobstack_freeopendirgetuidgetpwuid_rmemcpypthread_rwlock_tryrdlockstrcmpqsortpthread_condattr_destroy__sysconf__errno_locationgetgrnam_rwrite__dcgettext_obstack_beginabortstrerror_rpthread_cond_waitpipe__asprintfpthread_condattr_init__getsockopt64__progname_full__prognameraiselibc.so.6GLIBC_2.9GLIBC_2.7GLIBC_2.10GLIBC_PRIVATEGLIBC_2.34GLIBC_2.38GLIBC_2.4__gmon_start__ii ii c ii  HLT\dt|ęԙܙ @HPX`hpxȚКؚ  $(,048<@DLT\dhlptxě̛Лğȟ̟П؟ (08ԢģФEXԟpܟԜ؜ܜ       $(,048<@D H!L"P#T$X%\&`'d(h)l*p,t-x.|/0123456789:;<=>?@ĝAȝB̝CНDԝF؝GܝHIJKLMNOPQRS TUVWX Y$Z([,\0]4^8_<`@aDbHcLdPeTfXg\h`idjhkllpmtnxo|qrstuvwxyz{|}~ĞȞ̞ОԞ؞ܞ  $(,048<@DHLPTX\`dhlptx|@--qƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4G-p`MtVsp6P0hF@@000 `20SO(60P C&6 0 (@PS500So`P  p$W 0P   y+ P `e`0@S008E@  m$4 0 0jS8 `Pp  P) $S @ `P0S P0 0 r R 0@4@0  P f-M )4$ 0 p` P00: Si `P P  4 R X T R X# R 4P ;0  @A  @P  P N &}&P# @=:5&`4V <"@D0SQVSPV%@  g&s4010  ` 0@\10  @Hsd  RDD1 0  a`0S Q@_PX 0 @ )0 THDi(l00P"00 0 3Pg d0p00 "80H0 0A]dhdT_8d(cl -p@-P@P0Ms@`  0S 00`0  @ >$  Px 1H hP4044/0]XZ @-`@M@p  FP00Ѝ0 0\ |0@-8Q@P M!Q> 00S7 !RQ2 A @R0@0$0S  P Ѝ0@P( P0 S( t Ѝ0@d ,  P00040444 0{\aa``[` "SH-P"`4MQ 2p 00b"@ 0`0p0 $ @ @/ h  P 0<08b0$@0 ``C/@P00 TGQK p p" q 0 g) X0 S4 ^ ^pQ0p> $0 $ @T nPPP%nU@PQSQ 0 d0ddd 0T0TTT 0Z_ZYY^HX O- 5M$M0A-K0opP- z@P P `J R p P* ZZአ P @A=K0C TA=K 0C AK@4 00A=K" t40 K;T !  MT *`pM`Q`V:1`T`P0S A-K 30 pP{A-K 30 PA-K 30p S:K$0CP`Cp{A-K BK00S { 000 00SL XpA=Kp#0Cp 0 0 A K20 &p ᜒ! 0S pxxP3@A-K (20@0PS ,0`  U K Yo{AKp1 00A=KP[!10` K y I!p 00 0CAK1 00,`]-! 00pAK0 0AK0AA=K0CP@P!P0S + AK(00 T( [,xUY`lWA-p`P9 p@ P PU `N0S @HO- oM,X,8P0P1 # @P X P  7!00SkG @0:PL G@o. 0 -pa 7唧0 r  |7!01 K>1 0SZ1Z101  84GP@ G0@9K   Kn K0 Px601PvF@h2S;F@0S Np) L&|6@00Sep P6R0; !60 p7 K 0S/0S 1005x01 K P!p  0S 0S !6`P "<p@j0 S 0S^ 1005 x0R1 -p  0S P00M  [x 0:@`a @U 0V0@{ {RPv 4 P /@ P 00x 0S0SW-x  !x0(,G-0 00 0r <3<<<#0l30 p$3 01 20W0" XEoK0Six p xPaaK;P\0 O xQ 1000\xX! Q PPys00P  !2P `@ QpP 0!CKEKN ! 1 0P ,00p1 0p1 x`10f0L! K1 0$1 b@S sHP  0 SW xDVMVUUxPP$UDTOTPT T x  $ P  `JxN(  ,x|<XHHHL:(D$0 01 `Pd 0 Se0 `Q0  @ MA<10H101 `h/0 @ +l1 P0 @ 1!r`p   09p0S(2 !P0 S| o0 0RP TY `2!P [ px@U* a@HpU* Xp`᠁  MPp K;x0 )K0At0 5p0 0Sx K9p xP@Qa 0`@MP P@Pa0 @`&p  (0000`开 lh4"00PQ9 40004 P 0R\ax l9W`Fx@p#p3kV ~ PT1 ' +2Q !5P `90 @p' FPK!p  !P R  06HP r`!X6lP h` xR& 0R0: (`V v!,!BQ0P Q8 R< R0P    !! @'  ! t┡ Q   A A 嘑 a  rm P:P:Q!PU\A Q QpWP: P :P\U`P:Zt AZ|^CUsUpQmQj\fQdQa R^ Q ! rKCVᘑA}4 唡QQH! #PA Rx 1 P171Đ0(    10 0R)0@S p(: P8t#Q ^AQC^ gOKl!:P T1: *0@- 41R0@ MZP 0`6 0Sp( * Ѝ@ZP 0 P0 00@  Ѝ@~P006- pP, 9(< <H-PzPJpfMM@@$ 0: $ L0 0800P0o 0 0S D 0S  S0 0$00C@$00Sf ,p P^00SC0Sn4 [=000S p4 Y0wS0 \2},0S#(00 !RN 0S& P 04 0a P;  0P 0S XH @w$00$0S0S9p 00 S 0S 70 0E6W,>  V00' S  ' 1弰{ (0,10x00 0$ L` 0 T00P00<@D\!  80p10Xd10hl10S) Op 0S 60 0 b}0 0 0800P-00P S2 Yl S| 6 P2 Y0 W\1TW0 00, 1O0 00, G0 00, ?0 00, 70 00, /0 00, '0 00,  0 00, 0 00, 50 00, {50 00, 0 00, 0 00, .0 00, +0S 30 0G8\,@ W?\0 0hP04\2 [00S \3t0 0"4S $3@0 0 [2 .  , ~,P-"00 \ Qp!ర CR)SW/ .0d  `_ `00`0d00d0e\X,P,P Qf0   ,B]  <; 10 0W, )B p10 0`Y 100Y4|/ h109# 㠰0 G  Q0[0   R h0 !0@ 6\! WIQ1 S !00( 00 B@ 8t@(4>(2x\-`\td@72l22 T1p@-"`02 @QRPxM 0S $!@ 0 R)j`0P0 { c 2 { @xЍp 00 0P u{0h0d 0P 0 !j0`_0 0D-`0(00zt4- tM tЍ0O-%BM4M E嘵 @ (0,0 |% p P#p\E(P@P@-`0SV@0Bݍ4Ѝ@p`0D8 R 0 R `$P  $$@ 0  (  㠄p@T 0S  QJ @TYp00`FVP   ! S  7P 30 0H0 [ # q 30 0  #$0PZ000 0S    )P8 <30 0s  30 0# : 020 P 00 0 S0! Ps  x20 0|"  d" \   P 0s  B0PE 10 0.GPT1 p l! `10 /P-00 0 S0 0%  00 00 0 0S [$@ 00 0r   hpY  .x+...(D, ,x ,Ht*<0O--@@,4YM0 4  R b` 0Rd Rb`* pF 0S ; p P` 0H 0P* $0cp 0 00 0Z0P! 11X @10@0! 1010 0sB ! 10= 1!0>z0S 102/ QR \!  p <1<0 P0g@X00  @0 P! 10000s ! 10Z Oڜ0p00吀50P`PS0p`0.`%(l(l-\-a--h'H'+X&$ &*(@8%*))$)(#dt D  R00IY T00@1!00 0S0 Z0IYJ0 00S 00 R$ 000R 00 0Q 00  u0 Z1J1 3 Zd/ Q? @0P6 $0H& _pYݍ<Ѝ0PF H& Sp 001!0N1!0FH-D4@M$M00"@0$0 rpp04 00s10@0!ppP@00d4d000X4 0 0 0<464u,`0 ` VHT T{ # !40` S0`X p 0!10 R 0W0Dp!SaE0C!@r XT#0 R @# Q$,# Q# 0 S0  R5肟 r RC 0S 0QF TVQ ㊱V T0S  W0D p! Sኁ `FE0C!@r @0S  ; p PQ*]`F R p; `Fꔁ * p0S d0σ\P <@ 0T10!p@0pT1s0σ\ 00 0jp[ T @p h0hhh 0 D'!!&&&a4&|%H @$|\#(H8 t@- M`vrPpʜB@,,,x200Sh" 0S00PPBP@ @,TP[h0SBPU@200SQP@ ,P0@S0  %P TT 6p00 P0S  P tA@%!00 !dp@ o9(!0 P 1 0 01 500 0# 'Po4Pj |00 e`0l0 0  L!xlp!  !4 ,(lxO- SMdP`@4 8! @a $U  0`(a ,)&pO-P1EMM\b00X2`0@0SiP00kpL`HpG00p,`R. R0  p `40P0 sH"Z? wP H0L R  @ p4 P0S,  @ p4 0 ,040 0|4 0x4 00@HPP &EލЍ,0 CRSP  /0  Byp|4 ST00$0 Dl{P0p0 bq|(@-MSЍ0-$M 00 00 0 ?$Ѝ-M5Ѝ0-$M 00 00 0 !$Ѝ-MЍ0-$M 00 00 0 $Ѝ-MЍ0-$M 00 00 0 $ЍO-LM0܇pt$ P0P80 @ ( "D0 ,00G0 `R2p04 00< W0 @/o"@00310S  R)P<,00 (@P3P:`D@04/p@0s W  0@p0P0@0p40S2 0@p00"S40x 80# "RL t0s < 4 T  x08P T  x08  LЍ y0P40 04 0x08 "R 0 Rx 00 80 "R LЍ00x0 LЍ0t PD-M $(, ,ЍO-@LM40pp`xPD@y0P,0. t00D000P `4 p P%D0S 0t 0,cD@0T"P t  r  LЍ,PLЍt0@ILЍ< $ "@0 (0Pn9 |倐0[2 @/o"<00310S  R,@!(0$ @(P2 @@@40P4/pD0s [ 0 D000P0D000S 00D0"S0|t0p|D`0V t0@t0P00 0 0D etupD@T 0t t0 00Y0S@TD4-M $( ЍO-,M0$0p P0PSj!` 0 0V- @/o" 00310S  R& @$0  P$$@ 0P4/p@0"S0 V  0@`0P0@0`0S 0@`000hT T0p 0,Ѝ0P0 0T 0Q0T 00"St 0 0T"S O-,M0$0p P0PSj!` 0 0V- @/o" 00310S  R& @$0  P$$@ 0P4/p@0"S0 V  0@`0P0@0`0S 0@`000T T0p 0,Ѝh0P0 0T 00T 00"St 0 0T"S I-@ M`/pPTPV$ V- d0 ZK@ 00M10@SPPV0 K0 0\ԥNO- SM@1 04`0, < (! X1 V @ 081 0S 0PpXP101 00M0qPQ IT1  W0 0R8!  0(!L1 0 0D! H1  00M0041  ,1 pH10p  {p0{8 @$81 00\1 P10(0 , p TA0!01U 0QPE@Dc00 0TL1 Pw(1@ 0@S<1@ st(1P0 D1`V0 H1R  ,( P (Q @DD1@  0 00P41 ,1 R 0(o,A  0 @ 41S 8 Ks;  \<  41P S 0X00Sڔ0 0(1 g@XIK,`d  0 0S0 R0S41 VO0 p'0 p 100S5*( b,00 0 XP %`(W1 S 00 0 0@`L00Q 009uލ Ѝ@Ѝ/T00H 0000|p0xș@-|P|p M`@PpPP @TD0D0 0  0@ Ѝ(0O-44;DM (P`pPy ˟0 ˟9 ʟ 08<*  : 0(P$0,00 <8P0@8# R  8008P0S ~0@ S 00P:6 ` 0 S 0020P00S( 0 0S00:6  0S0020`00Su eP; `P [P ,UP OP IP CP =P 7P00ss P0ӻ 0ipe B` 0B0] 0(P0,Sj$0 0hR0`K0 A@@Ex@R: Y`8#;PDЍ 00  0S00:6  0S00200mp B` 02 p B`0P0 B0p@ 0nSS0oSP RM0B`2 yx&x6 000000T6P0@@6@0  0`H 0+ 0@mrp@ 0nS.0oS+ R(0B`2 _p B`Q0P4 B0pZP 0Bd2  <P050$EP 0Bd2 |002P0 ,P" &P.  P7 Ph xPPdP L40 I@4@- A P0$$ 073@m P- 3 0 (p@# 0nS0oS  R 0B`2  0dP  0Bd2 8P0nSj0oSg0Sd 0p@ 0nSa0oS^ R[2`2 Pw Pbp@ 0nSN0oSK RH0# 100  0 0@n W0= FPU10g`!400 00n4 80|IP0`AP0 $# {45Pu0 $$00o00 00@ 0`` P00Wl ($ (LܒВĒ$\ԐААԎ0O-M@/pB b " 2`!00 1  P!1BK  $.04001h 00删 S@048<DH  ( @ 4 L 8 P , X 0 \ < T ') Th0S 9/B<p Pߍl0l0 0@r,zߍ`4(H-M^T4P@  p\ VTp 4`X 400S   D 0p  00'0S9 p P@0S/p P3 R p렰3[#`"&hK[ _ <[0l0< S<l VZl` Vp}  p R0 000 000022儀000|0h0`P4 P00p`S R0 08 R<  Rx p`  lx0`QQx0tP`0dPT0VD0P0!@0L03<0)%(%($n8H 0D\l Xt@h@{ {{ {{{{{c|0[7 @pl $e M  p\ l0Bt pQ 0 l 8j>00;0@ p?  p(0@\ (TQE.DrtDqO-p AĀ(c1s, `P0s!  @R`0 S "P 0( S0S  R H0L 0 H0L <0S<`5@00@0D00D00S ĀO-,p(3 0LM0SP`pt@|u0 (0 0,P   0PE0``VPPGxPP   K0 ^oV0S0X P  P T T 40/R408 R8050S#  LЍ0 X  X \ \ Pt0  ^ P *0 LЍ  LЍ0@SP/0  00 05  0D 0A2480cX 1  ] 00XP\0\\ 0H0HH 0먳(l d$xDЇO- OMH 4 ! (` 1 Vx H10S11 !000D1 7V00M0 P1 0T1 74!H1p0S0!(! P'`F (!,10 1R 1 K ! H!@T# 4@T$ 0s EKP  RP 4 0 1 [,K 11 0@ 1 T11HYHoPH00/R0 P1xC@  Pc0S0S r 0   R@ @400C40 r0S?0/RH100HQ0S.0SmTk 24!bP`0 CQ S.0 K 0 K@TP0s KK ` H1 0A0D1 w10 1 I:K B  <0P T1 j@41L0 1 -4!41 H1C0A2480c![ K` P%H h00h0l00l0<00.0 00 00 00 (LQT8|P$X08 0R:// 0 0R://0@- M0@01!S \!#0L SP ! 0 0PS Ѝ0S 0cQ30 Ѝ0c0S< !# Ѝ00L 02<ptO- M}00 p@00P<(`,.S0V`A@1ATl0 W 00M0p0 _P 4=!Rt >0M0 00 (0S4 t d0 X P0x @Aph@ 0q@! h \ a`0 Pq U *X0 Ȑ@pf @R  ^Pq\`0d YxX0 U 1 !d0 `d@< 0i|< 0c dd<TKX 000 4lp00s APQ00 0S0S Kp0l 00 p`Al\^ \ lX Q Rp  00  0 s0PX0P\  T:4@ Q* Q*^:d\\\@@Q:ρ\p2 pl` ਀ `Xl0 Sh  p00f 00s`0 0 ^Q:fp\ lPp\0XP x0 t00SMt0 hY0000\p00 0  0X0 SGh\0 @Ȑ0C| 儠 P  X P. pW 4dX P \ `   R R:P` ` V X PXP P\` @`|儠X0 Sh0Xp00S: x0\0 l0Sl 0`ᨀh40 !Zd 1TV! @ P:0 000S:\ Ss: @ 0S,7@0S 0 0C000S~?0/R00 6&0:p00Q0Sl0S p0`10 `p010 0s0S0 0s0`00^1X0 :X0pC\00x0 p0l0QP1`0 DH0@QL0S,[,K< 0 0P!L H p(0S; `tTp P01s3 XP P 0\ ^,0Ps" 0 \,@0 R*  00 \    0sPXP(0`S   XP  `(0Sꌠd@2R/0#2"02.0l2lll"0 \2\\\"0L2LLb/08288 0$2$$$"02"02w 01 01 01!01^/01!01!01!0t1ttt!0d1ddd!04 h|w{(lx(xxdxw x4s twstywrswrsrwrtlwr\sLwtrr,wTrr w4ruvr8rvq\rvq rvqrslvqrLvtqps,vTqxs v4qsuqsupsO-200PP0R@M 00f, P P0P00(Ѝ\ (0100xpxp0Q 00S@S0 W # 2R C 0zP P Y*0S Pp0t0p0t 00,P00  0l l0  D0B2480c00),0,,, 0댖(rHrmq@-lM@d cPD0 R lЍ␀|  p0 0lЍ␀NPTL@-l0P0@MvP Ѝ@ @0 < 0 @ N(xq@-@ZP@@-@tP@P@-@ P@AP- Ma ЍO- M M, . >  , 00S0ɮKJ J< < < Q@ d;!P@8< 08 (4 >K0C< 048 B>K0C, .K B< ,4 0 , <, < `= 0< =NK0< p| /P2 >K0C< <^K0C PE< d| | | @8<<,8/<"S<Ss ZP 0< <s Y ≐ 0390Sr 0So   P >K0C< 2=K0C< <2}K0Cl nK pG< `F✌ @p @8< 0<<, 9/<P"S <s P 0l< <\ s P>K0C< <0< \ <0<,s00R 000008048,9/<p"S| <s P 0< <s <Sy Xw  ₐS <0S < SR <s K\@0S9 Ep < S <0S |L 0`Pi P0@000@P 1pʟ@ PP$0 (, @0 븬 <0S0/o0l"` j 0S0 0< <P R<40P L,<P G KSl< D AS<n k8 P l 3` @AP<sn|dY~ p 0 Rp Rp0S@ | 0`@ 0L< 0@T@S@T<帬  0000MH0p, ` R Y    R  Y\0 JS, < 00Lt,@0< 00 @0 p <@ 0(P<P$0 0, Q @! | p<  0W0S< s<p 0p0W 0,0S  0P)  H<  0 `0 <0S ,H60,<00  0  t5,00s  S 0C00 @@P@e,P2=KRnKL< `F 0< 娜 P P 0P< < 0S0R0,S000,ฬ <0000M0`< <0 ` 0, S  pᰌ Y@. 0S00S Ĝ l P` p,   PQ ,pĜ尬l 0S 0 0 `P , 0S3' ,0 < 04s   A <SI b 0  GP 0 0 0 00  <  0` @ p 娜  d`PN >K0C0<($,6/P  PP\ M H ^@ ` <0QP< 5 0 Q' 0< 0 `PdE 00Ypg< J0\0, v<  `P'Ul p` `p@<T<PP>K0C< <2K0CJ< 00< 0(4 0,40<"P<s 5P P<S <L 0000M`ጌ 0 0|0||| 0l0lll 0묒opatt\(VUdbTbHdb4bK0Ct4 0Cx4 TD `h l pt PK`^V \4-K0 B=K00B6/D^T`@tG 00S(  QS#N1^D 0x!  RT4X0T4 0`4  P40r 320S`  P$0S 0DDP4 D`^ P40320ST4G~KS ` 0SD4p4 01`4 0Cl4  00M0@ T4P4 0\$ l$ 0 X4 {X4\$0 \$ D$${@X4 0 0!h$ t4 h$0P h4 p4Ut4- Rd$ rP` Xv lRr HPlP4S000w wP@`P P}P 0/PGtPs+tC~K , ($ pGXD ,($ 06/p$ P%4Dt 0PP ZPD\P I\ 0T\H$\ AD 0"S XD,t4P d4S 3/P40  6xqPXD 0P  h$ B0h4  `4 U0@0P0SP000ho 0 S =H$R\4Sʌ nP D4DH @ 0Sd4s 0`4 (@@! `t]d]H]XbaGY(PFUDUUCUUp;1U|U C*0S9 dp 0@?o2T4 `4S0S  (CP @ 0( 0 @P4 rP4@0X4 01 0\$   $0PS000/o" 0 V00@T4S,|40S(ڸ10 P4 @qBK, Ax 200s  S0C0!00 @0 X4 \$ nX\ K\4S?\ \4\ 8`4 R00Sd4s@`4S0T4 n V0@@0J1X4 0\4 0P4S @?X\ K0@ P4 t@rv d 0PP4e S`0T4 P0 S30P4 Z  n |`4@P00M0T4  P4 @P4 0S}d4sV00V001X4 0\4 P0T4 `4 P`407P1\ X4 =4 00(0' P40 D^ Ӊ`@'S$50V/Y,5,,,%0Q<5<<<%0I-MЍ0-$M 00 00 0 $ЍA-@  p` MP`P  ,00,0Ѝ QP|  ,00,0Ѝ`0`0  0F0 @cPI@vTXT(pTG-@QTPpMV ` @T ,T#T@02FlA@X-00{A@ 00  @00 ,T :0DS0p  0 #SS @T#TЍp00  0 0 PЍ`H0L0  0 0 P8u(~(SRO-3KM00 0lC0P0 XPX p0 900300 (PH (00M(0 p (@ 0  #SS 0S  ,S#S00`|J `P ,[I `V82 00U0 @$rP$Z qA@ P 0A@ P 0A@ P A@ P l10X10  Kߍ   000 ! 2 R. Rk  0@Tc 0S`  0SZ  #ST  |00 00 @$PC\0000 @|LsRRRX(QhQPQDQTz@zVOXO0]xA-`Q@ }PP( 00CS: ¿8P08`P`MO-`@pKtᴀ QP|0S9 .p  (@P(  0P(0P0  #xP ` $0 P `(x4 00, `00(0@ P`T4TO- M ) 8 00@S/0 h0 X 0Pp0MW` PPK, 1  `? 㔠 l8`K0|0 d0Kp ,` t0 x 匀 V00,0 000t0x0 0 `p P0|` 00 0 P$0d03/P`ǿ`P A>0 $\0K6/P p4 PPpd`ಿ0P 3/,`V 87pP0LS= ,ZO Z ➾PX0XC y 00M ƾL\0"SɾPx F@ꌿ0S9 >p `  KP HDP) P$ P p00p0 0X* PP X - 00M {Z 00, oꌀx XE@A0S9 p 00M W, P P pZx匀唠 0 P` ` 00CU#Px tD@0S9 ṿp y0S44 ,0 p0 sp p (W ( 0`S0P 00 0 t0 0IⰠ`` ` 叿``t0`00 Sp0\` X 0(0I$0 0 x QG 0.0P; pGp0  ʽ0P 000SY0 0``0 ?o2 00᰾ 0S 0 \`X0h K \ K ` K d K 0 0SdP"\`X P K  P0 0 0Pt0h K \ K0 0 0hp0l p0 M  H10  `00 ៾ 0 AdP 0 0 0P`  0p0 0 Pp0 0pGp  8xPn  ix  T0TTb/0๾mvtMML|L(uQON(HEEHE)A-`( ˠpMMPC0$,č0(( PX8 0T8 0P8 00` P ڼ(CNP ӼQލЍO- 6"MM0X  `8 x@`PV@ p`@pW hp@0( S08 ;CK@KLt 88 04 , 4 x < D 咽5`(00S50 0 X8b@P 0 d8 h( l8 p(  (X0PP(0/00M|8 0P| S 00(0T\8 ` 0    0\8  \8 0 00(Sd80h8 0000  00Y0 0MYO X0W0 \8 (X H  o\8媢 ߼ZPl ټX ӼVP RWW 0ST o᪢ 0`X( @ 0@ @`夽d8 0h8 00!`  @(0S 0 RS |8S X80Su000XH/o"@ 0 ڼ 0S0 0<x8P »t840P lp KpPT 0S ႻP0XS0㌘吨 08s X匘吨0S 0 R|8d(S 0 h( 0 0000 X卼HX @@0PH 00!-K BL8 0X.K0Ql p8 DHd h8 `(810 0(0ᮼ}0S1 `(0 \8 ?V  W0 Q  00  0 \8 "V  W0 Q`X  P00H0HHH 0ྼXc(>@<4<(<=;;;=\=$)S-MЍ0-$M 00 00 0 $Ѝ-MЍ0-$M 00 00 0 Q$ЍO-@ԠԀp_⚺t ``P #10Bq抺t [ [0!03S T 00LS 0t0S [ T8[h<O-C S>C S=C  S=C SȌ@>08<7Q@0SP@->A AA'A6AAAAAA&AA)AAA A A2.42(crosstool-NG 1.28.0) nscd %s%s Copyright (C) %s Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. 2024Written by %s. Thorsten Kukuk and Ulrich Drepper/var/run/nscd/socket/var/run/nscd/nscd.pid%s %sSupported tables: %s For bug reporting instructions, please see: %s. write incompletecannot read invalidate ACKinvalidation failedOnly root is allowed to use this option!secure services not implemented anymore'%s' is not a known databasenscd.cret == sizeof (child_ret)%s: : %s wrong number of argumentsfailure while reading configuration file; this is fatalalready runningcannot create a pipe to talk to the childcannot fork'wait' failed child exited with status %d child terminated by signal %d /dev/null/proc/self/fd/cannot change current working directory to "/"nscdw%s: %sCould not create log filenotify_parentdo_exitName Service Cache Daemon.config-fileNAMERead configuration data from NAMEdebugDo not fork and display messages on the current ttyprintPrint contents of the offline cache file NAMEforegroundDo not fork, but otherwise behave like a daemonnthreadsNUMBERStart NUMBER threadsshutdownShut the server downPrint current configuration statisticsinvalidateTABLEInvalidate the specified cachesecureTABLE,yesUse separate cache for each user/etc/nscd.confconnections.cinner < nconnsdbs[my_number].enabled__builtin_expect (e == 0 || e == ETIMEDOUT, 1)/proc/self/cmdlinecannot open /proc/self/cmdline: %m; disabling paranoia modecannot change to old UID: %s; disabling paranoia modecannot change to old GID: %s; disabling paranoia modecannot change to old working directory: %s; disabling paranoia mode/proc/self/exere-exec failed: %s; disabling paranoia modecannot change current working directory to "/": %sFailed to run nscd as user '%s'initial getgrouplist failedinvalid persistent database file "%s": %suninitialized headerheader size does not matchfile size does not matchverification failedsuggested size of table for database %s larger than the persistent database's tablecannot create read-only descriptor for "%s"; no mmapcannot access '%s'database for %s corrupted or simultaneously used; remove %s manually if necessary and restartcannot create %s; no persistent database usedcannot create %s; no sharing possiblecannot write to database file %s: %s! dbs[cnt].persistentdbs[cnt].ro_fd == -1cannot open socket: %scannot enable socket to accept connections: %ssetgroups failedsetgidsetuid/var/run/nscd/dbXXXXXXdisabled inotify-based monitoring for file `%s': %smonitoring file `%s` (%d)disabled inotify-based monitoring for directory `%s': %smonitoring directory `%s` (%d)short read while reading request: %skey length in request too long: %dshort read while reading request key: %shandle_request: request received (Version = %d) from PID %ldhandle_request: request received (Version = %d)cannot handle old request version %d; current version is %d %s (%s)cannot write result: %sINVALIDATE %serror getting caller's id: %sprovide access to FD %d, for %smonitoring file %s for database %sstat failed for file `%s'; will try again later: %sdeletedmovedcreatedmoved into placeignored inotify event for `%s` (file exists)failed to remove file watch `%s`: %smonitored file `%s` was written tomonitored file `%s` was %s, adding watchfailed to add file watch `%s`: %smonitored parent directory `%s` was %s, removing watch on `%s`monitored file `%s` was %s, removing watchdisabled inotify-based monitoring after read error %dstarttime[sock] == 0inotify_fd == -1 || starttime[inotify_fd] == 0nl_status_fd == -1 || starttime[nl_status_fd] == 0nused > 0could not initialize conditional variablecould not start clean-up thread; terminatingcould not start any worker thread; terminatingmain_loop_pollfd_readymain_loop_epollnscd_run_prunenscd_init/var/db/nscd/passwd/var/db/nscd/group/var/db/nscd/hosts/var/db/nscd/services/var/db/nscd/netgroupGETPWBYNAMEGETPWBYUIDGETGRBYNAMEGETGRBYGIDGETHOSTBYNAMEGETHOSTBYNAMEv6GETHOSTBYADDRGETHOSTBYADDRv6SHUTDOWNGETSTATGETFDPWGETFDGRGETFDHSTGETAIINITGROUPSGETSERVBYNAMEGETFDSERVGETNETGRENTINNETGRGETFDNETGR%d%c%n%spwdcache.ckey_copy == strchr (cp, '\0') + 1cp == dataset->strdata + total - offsetof (struct dataset, strdata)fd != -1short write in %s: %sHaven't found "%s" in user database cache!Reloading "%s" in user database cache!Invalid numeric uid "%s"!*(db->data + he->key) != '\0' && *ep == '\0'readdpwbyuidcache_addpwgetpwnam_rgetpwuid_rgrpcache.cHaven't found "%s" in group cache!Reloading "%s" in group cache!Invalid numeric gid "%s"!readdgrbygidcache_addgrgetgrnam_rgetgrgid_rhstcache.c(char *) &dataset->resp + dataset->head.recsize == cph_addr_list_cnt == 1hst->h_addr_list[1] == NULLreq->type == GETHOSTBYNAME || req->type == GETHOSTBYNAMEv6 || req->type == GETHOSTBYADDR || req->type == GETHOSTBYADDRv6Haven't found "%s" in hosts cache!Reloading "%s" in hosts cache!cache_addhstgethostbyaddr_rgethostbyaddr2_rgethostbyname2_rgethostbyname3_rgetservbyname_rgetservbyport_rservicescache.ctype == GETSERVBYPORTHaven't found "%s" in services cache!Reloading "%s" in services cache!cache_addservlookup%c%s - %d: %s%s%d %sdatabase %s is not supportedParse error: %spositive-time-to-livenegative-time-to-livesuggested-sizeenable-cacheyescheck-filesmax-db-sizelogfiledebug-levelmax-threadsserver-userstat-userpersistentsharedreload-countunlimitedparanoiarestart-intervalauto-propagateUnknown option: %s %s %scannot get current working directory: %s; disabling paranoia modemaximum file size for %s database too smallpasswdhostsservicesnetgroupcannot write statistics: %snoOnly root or %s is allowed to use this option!nscd not running! cannot read statistics datanscd configuration: %15d server debug level %3ud %2uh %2um %2lus server runtime %2uh %2um %2lus server runtime %2um %2lus server runtime %2lus server runtime %15d current number of threads %15d maximum number of threads %15lu number of times clients had to wait %15s paranoia mode enabled %15lu restart internal %15u reload count %s cache: %15s cache is enabled %15s cache is persistent %15s cache is shared %15zu suggested size %15zu total data pool size %15zu used data pool size %15lu seconds time to live for positive entries %15lu seconds time to live for negative entries %15llu cache hits on positive entries %15llu cache hits on negative entries %15llu cache misses on positive entries %15llu cache misses on negative entries %15lu%% cache hit rate %15zu current number of cached values %15zu maximum number of cached values %15zu maximum chain length searched %15llu number of delays on rdlock %15llu number of delays on wrlock %15llu memory allocations failed %15s check /etc/%s for changes add new entry "%s" of type %s for %s to cache%s (first)newp->key + newp->len <= table->head->first_free(newp->packet & BLOCK_ALIGN_M1) == 0checking for monitored file `%s': %smonitored file `%s` changed (mtime)pruning %s cache; time %ldconsidering %s entry "%s", timeout %llurunp->type < LASTREQ && readdfcts[runp->type] != NULL(table->head->gc_cycle & 1) == 1run != ENDREF(table->head->gc_cycle & 1) == 0remove %s entry "%s"prune_cachecache_addmem.c(start & BLOCK_ALIGN_M1) == 0db->head->first_free % BLOCK_ALIGN == 0cnt < db->head->nentriescnt == db->head->nentriesoff_free <= db->head->first_free(db->head->gc_cycle & 1) == 1off_alloc <= db->head->first_freeoff_allocend <= db->head->first_freenext_data < &he_data[db->head->nentries](*next_data)->packet == off_alloc(*next_data)->key >= (*next_data)->packet(*next_data)->key + (*next_data)->len <= (*next_data)->packet + dh->allocsizeoff_alloc == off_allocendnext_hash == &he[db->head->nentries]next_data == &he_data[db->head->nentries](char *) runp->to >= db->data(char *) runp->to + runp->size <= db->data + db->head->first_free(char *) runp->from >= db->data(char *) runp->from + runp->size <= db->data + db->head->first_freefreed %zu bytes in %s cacheentry %zu in hash bucket %zu out of bounds: %u+%zu > %zu key of entry %zu in hash bucket %zu out of bounds: %u+%zu > %zu packet of entry %zu in hash bucket %zu out of bounds: %u+%zu > %zu full key of entry %zu in hash bucket %zu out of bounds: %u+%zu > %zu(db->head->gc_cycle & 1) == 0(db->head->first_free & BLOCK_ALIGN_M1) == 0no more memory for database '%s'mempool_allocmarkrangegcNPTLmemory exhaustedgethostbyname4_rgetcanonname_raicache.ccp == (char *) dataset + totaladdhstaiXinitgroups_dyngetgrent_rsetgrentendgrentIllegal status in internal_getgrouplist. initgrcache.caddinitgroupsXonoff%s: line %d: expected `on' or `off', found `%s' %s: line %d: cannot specify more than %d trim domains%s: line %d: list delimiter not followed by domain/etc/host.confRESOLV_HOST_CONFrce%s: line %d: bad command `%s' %s: line %d: ignoring trailing garbage `%s' RESOLV_MULTIRESOLV_REORDERRESOLV_ADD_TRIM_DOMAINSRESOLV_OVERRIDE_TRIM_DOMAINSHaven't found "%s" in netgroup cache!Reloading "%s" in netgroup cache!setnetgrentgetnetgrent_rendnetgrentnetgroupcache.cHaven't found "%s (%s,%s,%s)" in netgroup cache!Reloading "%s (%s,%s,%s)" in netgroup cache!addinnetgrXaddgetnetgrentX[%dm<%02x>version%08x: %24s : %10d %08x header_sizegc_cyclenscd_certainly_runningtimestampmoduledata_sizefirst_freemaxnentriesmaxnsearchedposhitneghitposmissnegmissrdlockdelayedwrlockdelayedaddfailedhash[%4d] = 0x%x %08x: type %s key %p "" (len:%ld) Data %08lx %08x; %24s : %10d %08x recsizetimeoutnotfoundnreloadsusableunusedttl - all data: V%d F%d name passwd uid %d gid %d gecos dir shell byuid key gid %d members %d [ ] bygid addrtype %d error %d aliases [ ] addresses [ naddrs %ld addrslen %ld canonlen %ld error %d [ ] canon nresults %d groups [ ] key alias_cnt %ld port %d (stored as %d) proto nresults %d len %d (, result %d - remaining data %p: j0:>Ca~vnHHHƾordertrimmultireorder]]//؅>A AA'A6AAAAAA&AA)AAA A AGNU ):[f([0[T[d\[[p([[[F[\t\\0\K<\p\gT\|\i\\\S\\PP@@0000P@00@   gggghh$h4hDhPhcXh`hhhth|hhlhhhh$Ё( `ngoooБظȹP@P&`@A (+ VHpo h  ȜX%!Poo!ooo؛4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+(,d \o8T PH@< @P30ܥ4\L?[<\; hgD|g<LgTgp\gpxGCC: (crosstool-NG 1.28.0) 15.2.0A2aeabi(6KZ  "DO >Q@|TTT0:O~)?@AqB !U(U !6 9&&6>A AA'A6AAAAAA&AA)AAA A A+$.L9+2YT0n d"*&rp.q J@rylz1 lz2pnivk%.?I;%.?I;%%.I;( $ > 4:!;9 IB :!;9!I8 &I:!; 9!I:!;!9 IB%   $ >  > I: ; 9   : ;9  I !I/ 4: ;9 I .?: ;9 'I@z: ;9 I Ic. O0/////0/1//0L/2f///////o. Q /00///0////00/00/10//0L/0/2///////h. TZK///00g2///00g////2/00g//2/0/g//K. T  .// /export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc../.././gcclibgcc2.carm-isa.hlibgcc2.hT.0  uJ- / .0 JK .h / J  hJ . oJ .0-/I/1 L.2*2 2..JM.y. i./.2/e//.J..21+/ ,/ | O | Q  | 0@TZJ FB J FJ F FF L | TD | T0B/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/config/arm/lib1funcs.S/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/build/build-cc-gcc-core/arm-muntsos-linux-gnueabihf/libgccGNU AS 2.45__udivsi3__aeabi_uidivmod__divsi3__aeabi_idivmod/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/config/arm/bpabi.S__aeabi_ldiv0__aeabi_idiv0isa_bit_predrescomplex floatisa_nobitisa_bit_mve_floatisa_bit_fp16short intisa_bit_secisa_bit_adivGNU C23 15.2.0 -mcpu=arm1176jzf-s -mfloat-abi=hard -mfpu=vfpv2 -mtls-dialect=gnu -marm -march=armv6kz+fp -g -g -g -O2 -Os -O2 -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fexceptions -fvisibility=hiddenisa_bit_quirk_no_volatile_ceisa_bit_mpisa_bit_armv5tisa_bit_armv5teisa_bit_neonisa_bit_bf16fbit_implication/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/libgcc2.cisa_bit_cryptoisa_bit_tdivconslong doubleisa_bit_iwmmxtlong long intisa_bit_armv6isa_bit_mveisa_bit_iwmmxt2isa_bit_cdecp0isa_bit_cdecp1isa_bit_cdecp2isa_bit_cdecp3isa_bit_cdecp4isa_bit_fp_dblisa_bit_cdecp6isa_bit_cdecp7isa_bit_armv6kisa_bit_armv8_1m_mainanteunsigned charisa_bit_fpv5isa_bit_xscaleUSItypelong long unsigned intisa_bit_quirk_cm3_ldrdisa_bit_i8mmshort unsigned intisa_bit_fp_d32UDItypeisa_bit_armv7emisa_bit_lpaeall_implied_fbitsisa_bit_vfp_baseisa_bit_armv8_1isa_bit_armv8_2isa_bit_armv8_3isa_bit_armv8_4isa_bit_armv8_5isa_bit_armv8_6__udivmoddi4isa_bit_sbisa_num_bitsisa_bit_smallmulcomplex doubleisa_bit_pacbtiisa_bit_quirk_vlldmisa_bit_cdecp5isa_bit_vfpv2isa_bit_vfpv3isa_bit_vfpv4isa_bit_thumbisa_bit_fp16convisa_featureisa_bit_notmisa_bit_quirk_armv6kzisa_bit_cmseisa_bit_crc32isa_bit_quirk_no_asmcpuisa_bit_armv4isa_bit_thumb2isa_bit_be8isa_bit_armv7isa_bit_armv8isa_bit_armv9isa_bit_fp16fmlisa_bit_quirk_aes_1742098isa_bit_dotprod/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/build/build-cc-gcc-core/arm-muntsos-linux-gnueabihf/libgcc/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/config/armlib1funcs.Sbpabi.S(PQ(+\RS\+ QTQTQTPTPQ(P^(\^\^\^\^\^LRS\RSRS4LWs( /0@K$( 1$#/r( /0@K$( 1$#/|s0)(s0.(# @dQUuUuUDPx Tp  h!!% (+ 4+ P3 V VHL؛Ȝ ! : :   % V , : 3: : (+ V @ 0+ V G V \; N\; ; ; x< < \< `= x= > > f> ? ? t? B DB PBq$ U X)j(( A\   3PdH8( I(  p @ O #2JT eL yVȓ   XB\  P( %q<GظP VP d " Q  <  .Qm@z$ H`P -X6G^o Pp$ X `, :  ȓ" Xt P@>Sx= @( d\$ P3@ (9Uj~T 0ܥPP  1| =xS `q'"   4" ȓ (:l" JQDb@  4P t ;cN( m  0 , "=csl PP g(+ t   +=P8j@P {4 48 &P start.os$a$dabi-note.c__abi_taginit.ccrti.ocall_weak_fncrtn.onscd.cprint_versionmore_helpinvalidate_dbparse_opt__PRETTY_FUNCTION__.1__PRETTY_FUNCTION__.0docparent_fdrun_modeget_statsconffileargpoptionscrtstuff.call_implied_fbits__do_global_dtors_auxcompleted.0__do_global_dtors_aux_fini_array_entryconnections.cfd_readynscd_run_workernscd_run_prune__PRETTY_FUNCTION__.3restart__PRETTY_FUNCTION__.6main_loop_epoll__PRETTY_FUNCTION__.2main_loop_pollnl_status_fdreadylist_locknconnsfdlistreadylistnreadyattrreadylist_condtimeout_clockserver_uidserver_gidserver_ngroupsserver_groupssocknl_timestamp.4starttimereqinfopwdcache.ccache_addpw__FUNCTION__.1addpwbyXnotfoundgetpwnam_r.cgetpwuid_r.cgrpcache.ccache_addgraddgrbyXgetgrnam_r.cgetgrgid_r.chstcache.ccache_addhst__FUNCTION__.0addhstbyXtryagaingethstbyad_r.cgethstbynm3_r.cgetsrvbynm_r.cgetsrvbypt_r.cservicescache.clookupcache_addservaddservbyXdbg_log.clogfilenamenscd_conf.cfind_dbnscd_stat.creaddfctsmem.csort_hesort_he_datamarkrangenscd_setup_thread.cxmalloc.cfixup_null_allocxstrdup.caicache.caddhstaiXinitgrcache.caddinitgroupsXres_hconf.carg_boolarg_trimdomain_listdo_initcmdonce.0netgroupcache.caddgetnetgrentX_appenddo_notfound.constprop.0addgetnetgrentXaddgetnetgrentX_ignoreaddinnetgrXnetgroup_database.2cachedumper.cthe_cache_udivsi3.o.udivsi3_skip_div0_testshift_divsi3.o.divsi3_skip_div0_test_aeabi_ldivmod.o_dvmd_lnx.olibgcc2.c__FRAME_END____aeabi_uidiv__aeabi_ldivmod__aeabi_idivmod__aeabi_ldiv0__aeabi_idiv0_DYNAMIC__udivmoddi4__aeabi_uidivmod_GLOBAL_OFFSET_TABLE___aeabi_idivpthread_mutex_unlock@GLIBC_2.4__getservbyname_rpagesize_m1calloc@GLIBC_2.4__isoc23_strtoul@GLIBC_2.38raise@GLIBC_2.4epoll_create@GLIBC_2.4__progname@GLIBC_2.4restart_interval__stat64_time64@GLIBC_2.34__getdelim@GLIBC_2.4getpwnam@GLIBC_2.4__sysconf@GLIBC_2.4__res_init@GLIBC_2.4__libc_start_main@GLIBC_2.34get_current_dir_name@GLIBC_2.4strcmp@GLIBC_2.4readdhstbynamev6__cxa_finalize@GLIBC_2.4__getservbyport_rparanoia__bss_start____isoc23_fscanf@GLIBC_2.38writeall__new_getpwuid_rread@GLIBC_2.4fflush@GLIBC_2.4_res_hconf_initgetuid@GLIBC_2.4__libc_fatal@GLIBC_PRIVATEmemmove@GLIBC_2.4__dcgettext@GLIBC_2.4__nss_next2@GLIBC_PRIVATE__copy_grp@GLIBC_PRIVATEdbnamespthread_rwlock_wrlock@GLIBC_2.34strchrnul@GLIBC_2.4debug_levelreaddhstbyaddrv6pthread_mutex_lock@GLIBC_2.4confstr@GLIBC_2.4register_traced_fileferror@GLIBC_2.4readdpwbyname_exit@GLIBC_2.4memcpy@GLIBC_2.4stat_uidtermination_handlermmap64@GLIBC_2.4_edatapthread_mutex_init@GLIBC_2.4hst_iov_disableddo_exit__libc_scratch_buffer_grow@GLIBC_PRIVATEmemcmp@GLIBC_2.4_obstack_newchunk@GLIBC_2.4send_stats__getsockopt64@GLIBC_2.34_fini__progname_full@GLIBC_2.4__bss_end__gc__nss_disable_nscd@GLIBC_PRIVATEstrdup@GLIBC_2.4pthread_condattr_init@GLIBC_2.4pthread_cond_init@GLIBC_2.4obstack_free@GLIBC_2.4accept4@GLIBC_2.10install_watchesgrp_iov_disabled_obstack_begin@GLIBC_2.4notify_parentunlink@GLIBC_2.4__sendmsg64@GLIBC_2.34dup2@GLIBC_2.4realloc@GLIBC_2.4oldcwddata_stringxreallocpthread_rwlock_tryrdlock@GLIBC_2.34mempool_alloctextdomain@GLIBC_2.4__getgrgid_r__new_getservbyport_rchdir@GLIBC_2.4strcasecmp@GLIBC_2.4__strndup@GLIBC_2.4perror@GLIBC_2.4poll@GLIBC_2.4__fstat64_time64@GLIBC_2.34setgroups@GLIBC_2.4__clock_getres64@GLIBC_2.34__getgrnam_rreadlink@GLIBC_2.4stderr@GLIBC_2.4argp_error@GLIBC_2.4disabled_passwdmkostemp64@GLIBC_2.7xmallocreaddservbynamexstrduppthread_rwlock_rdlock@GLIBC_2.34strcpy@GLIBC_2.4dbshandle_inotify_eventsopendir@GLIBC_2.4pthread_condattr_setclock@GLIBC_2.34getenv@GLIBC_2.4reload_count__data_startsetgid@GLIBC_2.4pthread_rwlock_trywrlock@GLIBC_2.34readdinnetgrmalloc@GLIBC_2.4strerror@GLIBC_2.4strftime@GLIBC_2.4__h_errno_location@GLIBC_2.4epoll_ctl@GLIBC_2.4__nss_passwd_lookup2@GLIBC_PRIVATEinotify_fdxmalloc_exit_failuregetdtablesize@GLIBC_2.4__gmon_start__pthread_condattr_destroy@GLIBC_2.4close_socketsrestart_time__udivsi3__dso_handlekill@GLIBC_2.4__ctype_b_loc@GLIBC_2.4stat_usergetpid@GLIBC_2.4receive_print_stats_IO_stdin_used__new_getpwnam_rstrlen@GLIBC_2.4setsid@GLIBC_2.4nscd_print_cache__libc_scratch_buffer_grow_preserve@GLIBC_PRIVATEdo_shutdown__isoc23_strtol@GLIBC_2.38__nss_group_lookup2@GLIBC_PRIVATEreaddhstbynamestart_threads__nss_database_get@GLIBC_PRIVATEreaddpwbyuid__nss_lookup_function@GLIBC_PRIVATE__nss_lookup@GLIBC_PRIVATEgetpagesize@GLIBC_2.4__divsi3__gethostbyaddr_rexecv@GLIBC_2.4pthread_attr_init@GLIBC_2.4__resolv_context_get@GLIBC_PRIVATEinotify_add_watch@GLIBC_2.4max_nthreads__errno_location@GLIBC_2.4argp_help@GLIBC_2.4cache_searchstrncasecmp@GLIBC_2.4disabled_grouperror_message_count@GLIBC_2.4strerror_r@GLIBC_2.4readdservbyportbind@GLIBC_2.4serv2strgetgid@GLIBC_2.4getgrouplist@GLIBC_2.4memset@GLIBC_2.4__gethostbyaddr2_r_endcheck_fileputchar@GLIBC_2.4argp_parse@GLIBC_2.4init_logfilepthread_rwlock_init@GLIBC_2.34pwrite64@GLIBC_2.4write@GLIBC_2.4setup_thread__end__pthread_rwlock_unlock@GLIBC_2.34__asprintf@GLIBC_2.4nscd_open_socket__resolv_context_put@GLIBC_PRIVATEserv_iov_disableddbg_logstdout@GLIBC_2.4__bss_startfclose@GLIBC_2.4strnlen@GLIBC_2.4mainpipe@GLIBC_2.4__nss_hash@GLIBC_PRIVATEpthread_create@GLIBC_2.34munmap@GLIBC_2.4posix_fallocate64@GLIBC_2.4epoll_wait@GLIBC_2.4setlocale@GLIBC_2.4__localtime64_r@GLIBC_2.34readdgrbynameold_gidprogram_invocation_name@GLIBC_2.4fork@GLIBC_2.4server_userreaddhstbyaddrstrrchr@GLIBC_2.4listen@GLIBC_2.4vfprintf@GLIBC_2.4prune_cachenetgroup_iov_disabledreaddgrbygidsyslog@GLIBC_2.4setresuid@GLIBC_2.4setuid@GLIBC_2.4readdir64@GLIBC_2.4openlog@GLIBC_2.4set_logfile_libc_intl_domainname@GLIBC_2.4msync@GLIBC_2.4putc@GLIBC_2.4__getpwnam_rvsnprintf@GLIBC_2.4fopen64@GLIBC_2.4qsort@GLIBC_2.4dbgoutpwd_iov_disabled__nss_services_lookup2@GLIBC_PRIVATEnscd_parse_fileold_uid__gethostbyname3_rpthread_cond_wait@GLIBC_2.4cache_addinet_ntop@GLIBC_2.4fgets_unlocked@GLIBC_2.4socket@GLIBC_2.4__nss_hostname_digits_dots@GLIBC_2.4program_invocation_short_name@GLIBC_2.4nscd_init__clock_gettime64@GLIBC_2.34__new_getgrnam_r__libc_alloca_cutoff@GLIBC_PRIVATE__getpwuid_r__nss_hosts_lookup2@GLIBC_PRIVATE_res_hconf__merge_grp@GLIBC_PRIVATEchmod@GLIBC_2.4inotify_rm_watch@GLIBC_2.4pthread_attr_setdetachstate@GLIBC_2.4fputs@GLIBC_2.4client_queued__new_getservbyname_rpthread_cond_signal@GLIBC_2.4abort@GLIBC_2.4pthread_once@GLIBC_2.34readdhstaixcallocinotify_init1@GLIBC_2.9setresgid@GLIBC_2.4send@GLIBC_2.4connect@GLIBC_2.4closedir@GLIBC_2.4argp_program_version_hookreaddgetnetgrent__new_getgrgid_r__assert_fail@GLIBC_2.4__time64@GLIBC_2.34__gethostbyname2_r__pthread_cond_timedwait64@GLIBC_2.34readdinitgroupspthread_attr_setstacksize@GLIBC_2.34.symtab.strtab.shstrtab.interp.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.note.ABI-tag.fini_array.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributes.debug_aranges.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_line_str.debug_loclistsTT'pp#o  l-  5hh =o|Jo!!Y !!Pb B%%Xk(+(+ f4+4+qP3P3"wVV}VV-p  HHLL؛؋ȜȌ8H0"p*3`֚p^(П50@0Pͩ.# L&r`