ELF(hE44 ($#pXXX444  TTT   vx?OOddd QtdRtd   PP/lib/ld-linux-armhf.so.3{!W X^foy0bxNsKvG(1Z: P nd&lF9k5D-S[cJ8'w2U_I*iT3g?tL m`qYM =67aR>j;rBzHhuC.pe\ ],V/"#+4E)Q%$A<O@zHz;08 4RB6$"FB$T 0bbR*I2<<u|irQ};JYg2 qQK9x>*2PX]C\n| W ^+{K!+x`Rfgetsstrcpyregfreeargp_err_exit_statusfchmodwritevsnprintfbasenamestdinwmemcmpputsprogram_invocation_short_namefopen64strncpysysconf__fstat64_time64wmemcpyexitlseek64posix_spawn_file_actions_initpread64__assert_failreaddir64regcomp__isoc23_fscanfargp_helpstrdupclosedir_obstack_newchunkunlinkmunmapmkstemp64memmovetfindmmap64creat64strlenargp_program_version_hook__ctype_b_locreadstrstrwcslengetdelimmkdirfeof__isoc23_strtolargp_parsetsearch__lstat64_time64stdoutrealloclockf64strcasecmpmalloc__libc_start_main__stat64_time64posix_spawn_file_actions_adddup2error_at_linestderrposix_spawn_file_actions_addclosetextdomainfdopenfprintfposix_spawn_file_actions_destroy__ctype_tolower_loc__cxa_finalizesetlocalestrchrfgets_unlockedobstack_printfrandomstrerrorgetenvcallocstpcpyfcloseeuidaccessftruncate64newlocalememsetvasprintfwcschr__isoc23_strtoulregerrorrename_libc_intl_domainnameobstack_freeopendir__getpagesize__nanosleep64posix_spawnpstrcmpqsortstrsep__errno_locationwrite__dcgettext_obstack_beginabortwcscmppipeerror_print_prognamestrtok_rstrncmp__environ__prognameraiselibc.so.6GLIBC_2.15GLIBC_2.34GLIBC_2.38GLIBC_2.4__gmon_start__ii  4<DLT\dlt| $,4<DLTlt,Lh,Hd (D`|$@\x <@DHLPTX\`dhlptx| ,<LPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlptx|        $ ( , 0 4 8 < X t       8 T p       4 P l       0 L h       , H d       (D`|$@\x <Xt8Tp4Pl0Lh,Hd (D`|$@\x <Xt8Tp4Pl0Lh,Hd (D`|$@\x <Xt8Tp 4 P l      !0!L!h!!!!!!","H"d"""""" #(#D#`#|#####$$$@$\$x$$$$$% %<%X%t%%%%%&&8&T&p&&&&&&'4'P'l''''''(0(L(h((((((),)H)d)))))) *(*D*`*|*****+$+@+\+x+++++, ,<,X,t,,,,,--8-T-p------.4.P.l....../0/L/h//////0,0H0d000000 1(1D1`1|111112$2@2\2x222223 3<3X3t333334484T4p444444545P5l555555606L6h6666667,7H7d777777 8(8D8`8|888889$9@9\9x99999: :<:X:t:::::;;8;T;p;;;;;;<4<P<l<<<<<<=0=L=h======>,>H>d>>>>>> ?(?D?`?|?????@$@@@\@x@@@@@A AP?P@PAPBQCQDQE QFQGQHQIQJ QK$QM(QN,QO0QP4QQ8QR8 (  @3BBBB\CPCLCO- M@ p D@p0 S@0@x@x`x @` SPX0  MPD00 P ЍO_BBHeP KP  K?@0C@-gS0 APa c0@S! S0 / h10 / T10 H10<10010  10  10 10  00  00 kg 00 00  00  |00  l00  \00 P00$$4-$--- ,,,D,0,,,+0P /@-tM `@T D0D D0 @  Ѝ?@ @p@@@C-p1 M0(@1T0`P$@T! jPW-(0S 1 R; $1$0 0u0 0 ЍW* @ (0嬐SP(  0S@0S6 0S6ph0p0 0F u( ! 00000 0?*( A*@Ap@@q@-`0M 0P p 0@S5 ЍᒹP @0@0P  0  08Ѝh 0A S8p@-QࠑM$ A@0P 0P 000#S`Qc`1\ @0P0 RЍpЍp0AS 40 0  $00 /$ x-0@-M 0 0@P ^p *4 0 PyЍ0@ Ѝ/svI- MP`2@P, pW  00M p  q /00Q00/X000M  `/X p  J  @KO-0`_|MP8` P,@00?/00  >L00OPo0 0H0Ph   = XPK X? X 0H`HSV[X 0HSX&XS X0 @   ?0  0I`0SS  p?p`  pT 1 000  X> ` 0 0 |Ѝ@|Ѝ 000  =p0V00 0S XD 0S RR0G 0S0S  =` nX , 000  0 S0 0RT0P} 0   0S  pP,L8@$<4(@D[Y [| [[?W $0S*00SF[W`,0 0R7: ", 00,0(p,0WT 8 000 R !0( ,   7 `PVE F VZOV V$ ; ` P *0  L  0 00  P[ $p`0V 0V 4;d`  ) 0   P[ 0 p,0$(n 0 V00   0S (`SS)SG(P,0 0R}: $, 00,0(,0ZC 8 000 R !0( ,   `PVx9 <` e P@`(0   0   0S8$ ,00 RF, (,0ZH  H 040Z$ $0S$0C 0(0S0 0O0Q 030#"6 0@p0HP {[3# "H 0<(t  l 8H`  _47 ` P &0 J 0   $p [P$ z,00 R, (p,0WH  H 000 D`V 6 V0,060 P$0 V  6   Fo0 Y $Y Y #Yp50 00 `PV V VG VVW $0SE*00S(p,p@V `,0 0Rk: Z, 00,0(p,0W  8 000 R !0( ,  pPU U`L U  4$ + EoK0 :0(0 t0Ppt0S 0l V  t0PtpW 0 0R` V*0  1( `p `p0 0`S% SS'S=P,0 0R: , 00,0(`,0V: 8 000 R !0( ,  PU~2 D` 0 P0"   $ H,00 R, (`,0VH  H %Y0 PU U  1l p\! Eo00 pi1 ` X PR 0 $ ,00 Ru, (p,0WH  H @A@AD4,@>@?TAt>><D>:;:l:t:8:97;: 7p573T566,444x2(431H0.--P-h.T.+-\*+$*&%%4)X%X%$h%\$(($&(`# ($$0,0 `↠@ Q  (0 QH!H8  P1!(,`0`0  54L1(0 00 0Y `PYp Y{ YYBW $ R7*0 R(`,P2YMP,0 \: , 00,0"RI 8 000 R !0( ,  0S 0 p0Y`P 0 0L2 P ^` X"0 x,$ ,00 Rp, "RH  H 0 m`YP0x0 (_`Vn SP0 S`Vb SPu 0 0  0 F0SU  (`, n$0(,0R3 8` 0 0' 0`,X00  R , 00,0"RH H8 000 R01(0,0P0Q 030#1 0{0[ 030#1 Q 0K0 00PQ(00Q X l}l00SpX00"S 00 pmp p00S[(%5 Q004 (00F0$ L000\000d0BH0 Pp`PATG, ,0(p0WH  H 8 00Q01A \P(0,0 0SH0 HQ010! (0,0 4`W0p0 PRUR\ R 0$ 0  L 00s0S0 ,0T0 Su:H00 (0P0,00 R3,0  x7`  ~S",},6=0SK,0 l,0  8X 0 W,, 0, 0D,0 ,0 ,0  0,0 00pHP@ 8 ,00(PQX00"S p00S  <9` 0  t9  0X000 `0  0r0s0S0LyZ 9,` du 0, P0@U0(PSH   H 8 400P01 (0,0 ``0PSUS$00C0 0$ 0  0Sb0S  RR 0շ ;@` 0T;T+0 OdX0t  t $0 B R /R] , 00,0(,0QH  H ( ;  f <4` Hp  ,h, , 0ql< ` , >0S ,  <`  'd,(0L(0 0t}t0$ 0C0S0? R `=l` - = `= -0O-d @PM`W pEP6 A?oW20Sp4PA 0Sk 0S" C@( R  RS (0K P0SX ,300S> 30  K/Pq W 20P 00 30 a/P+ P pPh2t0@ 00 X2 0Ap$280 00  0P 1000 BP5 0pP PP PEiP p W`5P0PP(  0S ,NPAW | s8 B00M00  M 0( 000 0040 0(KP  400 0 PP 8 8P( &&p&D&\&`%$$- M0L4P Ѝ- M0*P Ѝ-0@-M 0 0@P ,p 4 0 PGЍ0@ Ѝ/AQ0@-P C\@ M: 9000 Ѝ0Q1  A-`pl! M  @ PW P   P  8  ЍT3 $  PN@P* 0S pp 8 0S  ~ dP\0\\/0p 0@ 0@p Ѝ\$""p@-@r@`@M% s* P 0r0& P P D00 0 6@Ѝph P 0P P0& ( 0 P0& H" @"!!!p@-PMD`@PP0 !!080 0 PP" J0R  Y9  001S. \L80   R8@`   p00 0"W;W ,P 0SVp 00p W Zb 0 p S SP@0 3/0P  R9 0 00($ 0 |00J 0  0   $ `!00C0$S@VQ 0 @ P 0.S0.S0.SY \ \ 0 0?p `V 0ꊠ r`@V#0, 00 0i 0 Rs B 0# $0 0@V@@ dYy xYp /Y00Y 00 00I0 1W0CV[   @WL /Tl0 Ti  00I@ W0I @V. 0W  00  '"00@B S   0@00SZ ` VV,@00$00L( 0V-W  @  `V.W @pp$pT 00 p@7p `V n@Vp@T 00@00  p`i0p @0( `Vf0.S(0.S%Y6 \ 0 0I @@T ` VY p `V  0 00 P 0.SdY 0000 0V Y p 0S@00@T `0SV p `V 0p` `V0 0Sy 0 @    4R B  @py0$0 0 0 QS X 0(0acp  0R p00 0S0C0 3 @ P00@   $  05t0 01V.p@0$0)p  0S  p  0S} 0W 0 @yp `V @p@p@ `V \ p` `VVW @p\ p 0S p` `V x8I`8p@00 Z Z>ZW# X| ` QQyW 00Sy   WF X Z>Zp@20 0|0`IUS @03/0P  Ru 0 00(`$ 0:0I0 PP*00R>  9p@\Z MpV 0SS O0 0Y 0 0 0 0 Z0p  R~ cRW Z>Z00h0S0 00 $0a0p᛽0@0lpU 0S 0Z0 0 0 0D<080p08`@V 0c(8 T\D\  88  p"W0] W W#X# p`0 SS$0V5 pF R s S- pX 00=0$ 0( 0 0 06p 0S 0 0 0pK 0SH p 0S000`08p 0<0(0@0,00S5 `"V V. <V \c V[ ( `P7 ,0 0 <0DpH@@*P@DpH@ ` 0Si 0X < 0! 0 SR20 0*(&0 $0(0,000s 0`s S \Z' 0 Sb V# 0 1♼0,00T W<` `R1 0  `V V0`~@yps@ W `<`# `0 0h` 0R `0pQ@p 0S  `>V% V 0SR; 0  ` V W ` 0SR`0` 0 mp@ Zn 0IUR `$0 C0l $ PG 0S 0s$ A0s X  1Y 0 $0 0GR$W $0߻0 0$0@6P0 0;0$ 00p W p14 û4 @ `60 0 0$ 0S $ 000000 0  0000  Q0: W*  0`S 0X( 0a@ 0  DpH@@ 0 0s0@DpH@0 p?  R< 0p$ ]$ @V0 0p `V 0p `V  ^0W Z>Zꈀ1@,@V QQ 9 0 0"H9H0 0y0 0,V`MR hp 0S _p"  R 0-0@-M 0 0@·P p 4 0 P8Ѝ0@ Ѝ/2-G-4PoU`M 0S p@T? @0TH %T RQ@Pt?t  `? 0000H?0/0S*0?0 R W / Q  P Q R p>  > 00>00S 0S3 0S 0SH 0S (YW 0S8<>0 R$Z& RZ,Y R N@@ PC X @=  =,00QkYp R |M@d@ X!  Y0P @$@M!@ Q@ RY",0S 0S @PQ<0 Rv W 0S  0Sw Ѝp@Q =Q9 0 4P U 04PS h;0 RY W> + Q   P (Y R$T+Z ( ,$ Y pR70SkQ 0S :R0 0:00ЍY,0S$c(0Q,0h :@0@T  0R Pv x@PAP P@PU 940  0ʟ: P0¶Ѝ), Y$ Y#  0cP,0S 0S0900S 9 m|)| ^ 80 Ro W $L)Z ( n p R ,I㴘@ X  -P @,0S} 0S 10$P 8 2 80080080Y70 R W (`(Y pV'@  0,(,  (( Y 0 pW p  0'  0'$ Z(  'Q  R & 0  ' ͵ 0t' $ ,Y R 6X H7A@0@$bH6,  7 0070060P6p'00SppW 5 & 50 R W< & Q  P Q( (Yh Rp<50 R W &  Q( YS  R $ 0  _% P 04 Q 5(0|$Z 0SX40L40Q@40 R W 05P0 0[ @A# 0  %$ $ 0Z. R$Q  +  Q* Rp40 0C4P3  p0ㇷ0PSp4 @4R0 04 R 0S 0S20 Rhp30020 R 3R00 pl2   30 0S 0Sj$20QRP#p   0S4300!$ 3  0Ĵ,0S 0Sd! 0Ȃ  B"@ q 0R RR  0op" ad" Q 0 0S08  Y$2 002 0 ჴ,0S$1P0 0m 1R0 0f R(!Y <ꀷ  $XpTD @8Գ|@x<Xp$0xX4h ($X8L @  ,Xh8X  <TLX<P4|PT$DP4tD @$ R*  ( Q Y ~@00 R?  Q   Rr Rp   0{0!0 lPN @0P>Q \  0S aAJ p&`v * L@P@801 80 N00!@D Bp@ PYt[(T ~{@0sР̘+t^(0((( 080888 0O- VM M00ϟ@FK p < t% (5 嶍? tT `V: @(5oPSP T`' T00ST00S"T00S L D/ℎp5 3,/ 0t E K @⺍T T <@, ΍@<%>NK@> @PQ~K0 PpG, G0 PH  K0 P@ 5% C&  R*4% $ C R@@(5$ PU- =PU 0S 0S4$0CSQ0  $0S P@U@ 4 R@T$ P ,偍0$4 (50SM(%B>K,D5 0T% <X \u  R (,05 D505T%RD% D% : PDpW Ee D~D b P5 W 0Y0 I8% 4 05 !P8%4050SK  (,5% C@e % BR+, R 4O@%   R^ B  0S 0% 0 R05 Ee0DDPU DpH5% C : : 0`D / 50CS40C#10c@0% 4U Q3?0 8 LE 0SP@F P 0SDp`W V0%4U8LE0`F5 `0S0 % 0 R(u,e0 4 H U    AP: P@e `( ,04$4P0B0S00_S;P4 0Sa0% 0 RU P5R % BR( D [     %BH$40C%#1B0c=DpS@$0H05 Ee054$X C\u @ $ @4$ C  Q*,4BK, A , H@ ṋ ᷋ ᵋ5% CM  R4% $ CA R(5$ t ,0P' $ @P$ t&, H( @IK@Z 4 4 4 x4 4 |4 l4 B 6 @0x5 6(0`5 \*6 !r 6 # Ph x \* &p & pxxa d l | E ,@Tj lh3L0SW 0 0 B"! bBPU Tu Xe \ L0S P U  p ` EP!E1!0RU  _ PRp  0L\A CM<h$  A^ - 5_PR  B=2/  0R 0  P C0^1 Q 0L@TPUTuXe\6&pW`:l|EoPR  B  0`5 `00CSd5 00CF#10c<N\ 3?00P 0C3?0`LP `0E 4% 8 D Le 0S @ ` H/P H!0QpLPUX00E4%8DLe F\00P `Q`0u PPp@V   @ 0CQ0OQj 0P`A @0u`@  C R 0OR_@0 S"0u p@ P0@S  ` 0Q 0CQ5_Q. 00u@L@T(00P 0C` GJpn`\gffffxbaaT`_0}z0S 8@@$ 6& 0 `5 ` h\S:p|$ 0 `M0\@M  P1 0p0e 4E 8U D p W*X0  㔔ldY@QL5 P @T  PL5XP@ p W0:|$0e4E8UDp 0 x40C| ! |$Q:R. 0 p4U 8 pW*Z0Q xT0e `ᐔY@QD5 L% @ T   ]PD5ZL%@ pW0:0e4U8D| Tw 40C qDR:|Pp4$Cp4 210h4 34  喉 哉 A⎉4 A≉4Sp 4 1ps$2{4W:|4$2P@ x4 1Ps$2h|$4U:4p$ #l吉 ᴈ 4S4St4S Р, H @(5p0S  R R $ R@0Sؙ 5%CQAQ$[ $KS0! 5 5 I(5p`VHE@`V 0S 0S $0SpPP 0 W1 pᨚ 0S5%p C  RJ% P %0R>: l5 0 R5 .% p %0R : Y0000 %Pc0Rt: Q F %(p0@6<P 0S07S Cpp5  R %7Ppp 1Rq: 0%S50 C5   QC 1<ϿQR,P5_  R@`PV% ^  n  ᜈ H(E,c X'Lǔ100 `M 100@RM P4 0 p0e 4E 8U < pW!*Z0s (4W\`V@QD5 L% @ T+  PD5ZL%@ pR0(50eLǓ4E 8U<(8X P' B0s10LǞ8 Q:\3 0p(E 8U < p W*X0& PW 4e `80E Y@QD5 L @T  xPD5XL@ p\0054e8U<(5 (5@LQ D70C p(@R:(5@L(5p8' RX74'210`7G478 େ@ ᪇4 ᧇ8 A⢇47 A❇@7Sp( D7 1ps8'2@7W:(%L78'2 @(uPP7 1@s4'2yL'87T:(E 47X'\#᠇ Ć <7S(5H7S(5T7Sp5Р >\, 0 tP,H@ KD5PL%0eZ] 05 0 )|$pW05S:4U8uPL5PX L5 0 )pL5D5P0EL4eX 05 0 )Lǔp W05 :8U<2PD5L%Z D5 0%(5X'D5,4 R,Pp >. 0qHx5 (5\`z(5P\r(5DXj8PW(%\4W]5 KW(R5 %K%0D?5 945 H.% 5fl?x93ꐔxTDlT唔W@4 RH5 @(5,t @4 g,1zJ0% 0%0Qd 0Z 0CSp1ppp!0 pIP0ePP ` p PGtP0E4e@iP$0 00 00 00 00 00 0{\Plw0~ wp}v}|v}\v| <v| dv|O-M` P /S  @ 0r/?   堟Op @8p0 00nX SX20S U00 0Z0S ?   R;╖0 0 00)(Xp  0R$00<0= 0X80<0J P>00D>80(08>40,0 X/  0HWS00 0S! 0S 0S$ 00C0 0000 0S0 0  d>(p , 000 X> ,  - ЍO0S$0d'R  R =p WXd XX <0, 40S 0SS0$0 00)40S<<080000 0Sy$0d7S|80Y p@ AP00S YVX ]WPv XP YPV0Su 0SS 0S X3 Zf  0S8 40S0 00000d\0SV00!:0SA:0pW@ 0S Tp W  Pp W@ /0S)00! 0SV@90 @00 0S  0S0 00S 0S0 00S 00000 0S0000 0IS9000 0 8<8<0ST 0$ PQ  B 0ߓz0S 0S0000 0S$0pY X "@Pl8 p 6'0 m1Tz0St Rf000 T0S[$00s0$ 08^0$ 0Z000 :0SB0S0@ 00B0Su 000 Q4 Q ?Q 6 0<0,& ?AoЍO0S$0d70CS,0$ d7 0S 0S0000 0S $ 40S00; $4  0 0 0 00M0800 00S 0S40S$ @TB 5 p }$$ 0@ 0400S 0S40S0 00400S 0S <0 0 0BRS0000 {0SSlS $@$p l0fP>l00V0 0z0St 0Sf0000 T0S[0000 H0ST X $0W t0ǒP  t0zPB0S< 0.0000 0S#0p000 0S YX $@ 00p%P @0S 0000 0S$0 @T p  PYF @T*@0 0$  00 @UXN0$ d7U!P P<0 0 0S 0S 0S| 1p dp0 0ᑐm$(xu$Mv,s 4p ᄼH.0 0Q    w80 0000S= ?S > 00].   0 40 `@0=$ 1!CQo$ @R$$ S0! 11p  @ ?p "/ ZW@ R2 ?p /0 GW0 D0W2 \ Y  tL0HD Ļ8tP?L0D HD0帻t 80 dSRD00$Y  P  D  GT $ HXu\WL@@`0Dܑ0 SX 00R1!8T0 P呼 00pP  0 `8d 0R80:!1DBQ\塻1!ኻ刻 冻 3p z|#0 `0S p $01LP$01P$$\ 1!R0 0C!RЍ 2p >" vS h2|p 0h" hE 02Lp "804"00 W@f1 p !  D- 0  4Q0HXS0 0M$00S$0@D1 0h0X!   18p ׺$@u!1$uܺ0 1^0 p 㺺   qGHL@$ p RRP h0hhh 0਻ZZ [Sx*XRlXdRZR>Δ\Ѝ0 0  0L 0y \΃P(0((( 0=(Z\Z d\YlY -0@-M 0 0@ᜉP p É4 0 P胺Ѝ0@ Ѝ/ tG-@`0V0pM @@P@T ׹PV 00 0  ЍG V 0a@0DpЍ80<0 0ӹ0 @` tXDXO-Hn8 MVp2 @P8@UP1T 吹PV 00 0墹  ЍOqV AUHu ]!<>H>0H> Ѝ@H% 0S\\4080 0{0 㩉 WLW0A-pP  N7"aF@D RM7@*apg  a|: (>  R PЍU QC  \paH pRT P* !0ӹ0  !a|( >U ($ \( .R* ^($ $R``" ᐋ0 ` R*U ap0z0$ p(  0 l p  0@- P@\ M \ L\ >\ 10 0宸h! ~0 Ѝ0<10 Ѝ00/0P@0 p0 p  0 Ѝ0 0 Ѝ0 0S R0  Ep 0 e0 3P  G,SXA-`0@SpM S" S ЍP@ 0s* 0 0  00 0Ѝ00 0l! 0 ⾸  P 0S 0000唸 ށ00PP  zPX  0BQ 0S,,00R1! 40 0Mݷ0 t;C-@M\J 0`S<<0  8P$r0@pPP U0@"0P @@@(@ @$@4@,@0@! ! ! }! x! st! nd! iT! dD! _4! Z$! U 0S\T<40 L> 0 0 ~0-@A 00040 S0 0|0S0>d0  0LЍ\POOOOoOOOOtOlO(OOO-@ M 0Pp 0`5"R!*0~  <0C50<(| 00C4 001s S VT W T S-*@ Ѝ0S  00Q  053,@ BS5>* !1r (0.1sp 4P< ! R 0 0PU @ y>VW 0P  R 06  B@!B0 ЍS* y  S :SPP"00PS:  S*!r1;$ (PRK P* .0 $ 0$ 0 #14Ps <y 4P"S    P* ,00 0 ( 0 00͈U(0.14P 000弈0P,0 004  0 孈 P $ 0(?O-,MPP S Np@810 0,1`00 10r00  0 0$1<1@Z*   @hPP 0 S 01 $  ⰶ TPPP0P0 0徵80 0,Ѝ@JpH2 IdGO- LM ` 40> /@0#@00o0 80 d P`U ⎵P 0A RĚ0S:@0S@p<` @0@T*Ȏ Ta08 HT  0  U@0@T:S<` >@p0H0 >0`D0 >0X0 >0\0  P0N @PP P$P0PP PPP(PY 0680 4@0 Lp P 80< PUH*4V!Va@0 0  0w2IpG2 rX < : X :X! T 冇 0T X :  0X*!0rZ 1(sB  Pq1<11U:LpPH0 XDPŴ, 0 \ |@0`V0:>Hp9H`3'^ -^KH? T / ⢴Wa H>S @m^`  ^@A0S0  R0H>@SS} x{mp`@ Tp <  P 0<N @0 PPPP P$P(PRpP(PL FPUB*D0Y <00 00JNI0 X8 :Y  X :X  "P ʆ 0P X : q 0X*1s 01s( 18 P0(U:LH0 TDP ),0 <0@ H> R@ 0:<@,PK}Hy0>>>>>>?>?(0 0> 0H >@0$0>> 0L0 `0L`p00K4 K(KPڅP,@p0 <}p PdM> 0S 0 `0L <80V#4#<01sL 01s0 18(Y|<"Sf P*0"3$0 $1 RD   P* ,T0  T0!Y ("SV  P* !$0 $  0;Y 0 R01   P* ,P0  P0 !1  T ɅT 0  00 T0 庅T0 0($0  P 孅P 0  00 P0 埅P0 0$0(pV`0`V| `p0Sx d00<0 M>80 0刐 00@@ MP   a0T  PP kP `v4 v V980` <P 01 DR00S:qP T. BW` a` a00T0 0H@`% <o|`0 1 L0X@*`` a LH0 D@sx#? +`0. 0R ? . ` ~W `0`0V100MY`8 @w Z@r 堲PPppW@ @08S p FP@< ` `0V@ `VpXp ᣄ᠄ /圄 p/嗄` 8p <0/P8@<0 Aq8 ޲Ϛ8 ? P 0U80 q @β Ϛ /P pU0@ /Xpa8 0!@(/$,? K Q 0I!ƱppW Yt 0P0 0?? ?@p 041d d0 H 0D0 @@20?.0?*0?&0   pGdEpD@<<:O- lM?d 0H0 0S`0 _ d0@`0TO `0$L @  `0PM 0pP @    T`04S `@ ' 4Q:`04` E   S`04S `ΟA  ! 4P:0 ) T`04!8`04S `TΟA `04R:(.090T dࢿ@PB 0S Hp? 0L0 ͟= 02`0$010`0P>S 80K0 \0P UMSBB$: XSR (P0 T!,9H L v h2000T0000RPR|'P0 T8H` L R lR`0p`$t09 @H 080 L0 86 02P0c d෽0P  R H 70 L0  L`a A00[SΎ  PDQYTPUP0[S  A0B9S00[BP0S  0S `0  R΃ 4S  Rd00So d Rk `X |L`    @P MP ʮ0S  ˮP@  IP  r- \ @0 R 0 P*Q @(Vh6@74?74 6ȍ=p5@<43\3t3222/24/8Y.,./)%" L%!| L" !( L"`"`#@y>` $ =tH|T$t@PT< Hr 8\d4 ` L( B!!T E PĆ#$( B B!ĕ L 0ą0@f`0N`0΃ K@`04S_ `0$00 B00:S 0` 4`04S4 `0܄br@`d`p@(T@ `  wT0Sf kTXH 10 L0 Ǭ |0 ,0B Q( 0SHH800R !( , 40 0T0@(T 0` 4`0.R `P 7m@T*5qQ Q0  s0 @ .T:`m'  0S'>0P 4A`<0 4aP0X0 4H0\0 ,4`0h0 80K;KT0 0! hT Td冺0PL0 40 P0 pL5 0|` P0M  + Q` 4Sb $ B`04\:`0U9d`00 Md00 ,0B'Qd(0(SHHd800R ! 0( , ` ܄4d00,0 A'Rd (0( SdHHd800Q! 0(,`$4H 60 L0 倫7 0070{`0DE T51  " `0!0  @  @90?@H t7@0 L0 O\8 02P0z{,x d͹`P 0SI 0` 1  `0 d080ู`P 0S H 880 L0 9 0090H{`$$08$04900``dp00 F0 0A0f0 0a04 d|`Pq 0S 0` 1 * `0 d020g`P 0S H |9$0 L0 ͪ@: 00L:0z`0 d00200tF`P 0S~ H :0 L0 嬪: 00:0z`0 d(02(0%`PF 0S< H : 0 L0 勪(; 004;0z`0 d40240\`P 0S H ;0 L0 j; 00;0z`0 d$02$0`P 0S H ;0 L0 I< 00<0sz`$,02,04z`@da0 "Z`@dA0x@Q .xQ* d0 0 S `0 0P5 o`0< 0` 1 ) H <0 L0 8= 00D=0&z H  =\0 L0 x= 00=0zd@( ,009d@( ,00  dX@P dQ@PH =0 L0 庩> 00(>0yS@vH (>X0 L0 墩t> 02P0yh d 0Ph d0PacH> 0L0 偩 y>` 0? 0` 1 *   d`PH ,?@0 L0 aX? 00d?0y 0` 1 *  d׷`PH ?0 L0 @? 00?0jy 0` 1 *  dභ`PoH 30 L0 3 0030Iyq 0` 1 * I d`P-H p30 L0 h3 00\30(y/H3 0,L0 x0S`0 d `0`0 2H 0PL @% 0` 1 *  dQ`PmH `20 L0 庨t2 00h20xoT d7`Pi< d0`PbH 10 L0 器2 0010xX @H 10 L0 全1 02P0xb d`P d`PH  1h0 L0 eP1 00D10xu 0` 1  > d۶`P"H 00 L0 D0 0000nx$  L,00 u100 04 l<XXHtn p8O- MP`H>@ 0tP 0 H@JP  Ѩ `0K0 hT% t0堐E>|0 G0p0 >` 00 p0IsTt0p @0SWt pH.0AR,t 0.0 R$ ! 1 00 M QMp ` @6 0`p0吀 h 嘐 Zp *h0W0h0 i 0P(x` `l EAZ  ੧Ph0 W l `0Rh0 xP吀@嘐 `$p1 0  B0p `S:\2 0p`0h@ @ 唐  Z`*h0V0h0 % 0Pxp pl EAZ  `Ph0 V l p0Rh0 xP@唐 `Q 0  B0p S:`@p倠0 "c$0 210,04i 2 h h p h Ah 2 Ah 0Sp 0 pq0zh 0W:0 2@` 0 @q0gh 0T: 0 2$ (#h g h0S0S 0Sp0 0p0 R|00|0 ``*0 9i Kh0lxp` VK 0%Ḧ Z`C:P @Q㔐`g@rh0lx`p W 0%ᜦ$Zp:P᐀@嘐 G0FS00 ht@pP>  'h hn0R$0 1 00 M100 @QMp 8 0` p`0@ h@ 嘐 Zp *h0W0h0 & 0P(x` `l EAZ  MPh0 W} l `0Vh0 :xP@吀`嘐 $p0 0A0| !  S:R1 0` 0唐 `0ጀ Y*Z0 Ppx` l E`Ah0 ` V  Ph0Z`< l  R0xP匀`唐 Q 0  B0p S:@0 s$0 "201,0g 2 =g :g  6g A1g 2 A,g 0S 0 1s 2g 0X:0 2@p 0 1@s 2 g 0T:0$ 2 #(2g g0Sa0S[ 0SUx`&K Zd h0 0%r Yh0Z:P 匀Q`唐{@h0lx`p W 0%T$Zp:P@吀`嘐h0(Pph0P`7 0S` (2]/TPph0(Pp(#  fF|0 fA !gt0p 44@TtP5)*4  @ f f4S gtPp 4)@T*4 kf4 @S f|0  e f g t0-> ft0+ e ft0@0S @t`@P $f@0@S f e ft02 1+ft0t0 `/Γ 10M0 @RM P7 0ph@ 0@ 匐 pW*h0X0h0  t0l` ^0` x UpIpWg   Ph0Xp x `0Rh0 l`@P匐t0Γ t1 >0C pΞ R:\? 0 pt@P hP 匐 pWZ*h Z h P ^ 0 0P pl@ x` G`A ? T S` V#  /Ph0Z`M P0Uh0 :l0x`P匐t0 t >S: . Bp10t0>Q: Pt0pt ?10!10?Ae> ae ^e [e AVe> AQe>Spt > 1ps.2Be>W:t >.2Ptp > 1Ps./e.>U:t@ >/#d zd e>St0>St0>SРt0 et0 dt0,> 4et0,> -et0 dt0 dt0-> et0 $dt0 $/et0 (/"! et0 $/et0 ,/ "!d} dyt0 dst0 dn Net0NTY  d d d@TLt0 dVt0 dQ 1et H>S\ P`M@ vdH>PSP P h0px l`Xu 0% t0/m pPh l@x`0Z 0 )>h0^P匐h0t0^@P匐tt0آ`S. .0S& X R pW D 0S) @@0S(  P0S pW[NT 01 @0T0P0SЍЍP Ѝ X0*X0X:X( 0  0:tP\O-ϟ M`SPh x`  gx  @?h @P@ 0   CpW (W@@ 0`S& W< 0T o8?0|0 ,? `00 ?00 0P W  | pG7Wpp pW h H?0 P0 ء. T@0  Tp0WTh> 0TP0 庡D. K R Tֱ 0 T@ 0 0 Ѳ0 S 0  Dz0SS S h =0 P0 偡h- 0S T@៱0   ᦲ0<SSSh h=0 P0 `, T00S000T ᇲpWW= 80GSeP0 0  T xp WZP0QP>S h 0 00D5 S q0  d0 d0@D% 4UD%W W 00 l0`S00t M0@0  lvV l`P 0R{`PF0 pR0 0 m HK  圞p`0 H  R 0 叞p0 V3#H @PQd` V(( ^  M p 0  @ P \0Sd d0`Z:00CHl0 i000x P-PD@T 0S 01  @Pp 00F`0S 4Q $4ĉAQPd0  x,hd0PW h 00 l0 BT0t SN:d tPSp:p`x`l` p`-l$($\x \,T@P$, |h\0S? d0P0U0 l ឞ P儬@P; 0S" V`0S 4Q 0$S@4ĉA $QU|P M>0000S 01  D5 Sx R@!0UDD50  W P=@P g@PZ)  g0@ AR 0R,, Q!T P3 t0  P@Pt0) P 0nlB@h P20 d0 sTE 00 u04o04o*B@?04o04o\h $3L0 d0 =Tsh X3|0 t0 0T3D5 S!0DUD5UP 0 0 00'0ot0St00 M>0 00 "R7% 04o o4h 40 d0 0t   R # 3T  0) BR2 \ ,4 0 p0pd0 $0P    0S0S0 0屡 0 0S  Ь0P    ֭`@Vp``T@Ὤ6x0d0 080<00 00Ὥ0<SS   =SH S S0   ᩭ0SSpp0P 00᛭0 S0 00ᑭ0SS  pW 0 SpP nP  >S_  0S0e0 嘠0 00e0 CRSS.SP  ePu @/8/S.0   Ӭ0 0P .R 9h P ኛ* Z( ^~~0 kឫ0 0PP0 @H/@0l0d `\70p0   y0 S0   o0 RED R Q P\QQ< "RgIP0H~WK ]@P@TC PW<P@ lP4?U7@?U4*\0PPoR$ R#$#, C40 A c0 P RD R Q 0P 4>\0! 0P    `@p`:h $8$0 P0 忙 8 (0T X0 'h00 P0 孙PX0PU # 3 x>0>0>#h t70 P`XP0 呙T@bᳩh (7<0 d0 候$7$'0T N04 l04l z0^h0h 00 P0 h h00 P0 З>0 0Ϙ0 0ǘ \dtL`hPdl$0@d884<DL`h0LX^ -0@-M 0 0@gP _p +g4 0 PzЍ0@ Ѝ/tO-@@娏TM 0Ss 0S 0S 0S 0 R  R  Rq  R RS $ R ( R3 , R 0 R 4Z 0#>n00>P0 0>`08@00 R00 SX>00P U@`N U@P`[l.  p PW ppPpW?0 0> 0'g=P0Sq L?p - f-0 S  0S 0SN 0S 0vЍ>X0 0ǖ@ fP`Q 6Q2 0 ㉛@@ T 0@@So 0SD 0SD<P0S <R00<0,  R9T,P R S d< 0R0 Q)  R 0S0 0-$,  R  R,  R R S ; 0R 0 Q  R^ 0S$ 0`+ RT SG ;0404+P R+ S! X;0 0R4,0Y Q( *P RC S 4;Z000*P R  S :( 0R,$0J Q 0 RI 40S 0T*P R2 S :, 0R0(0( Q 4Z0S00#)P R S :$ 0R( 0O Q , Rx 00S 0)P R S: 9 0R 0, Q $ Rh (0S 0,)P R S h9 0R$0 Q ( R7 ,0S 0l(P RN S 9 0R0 Q R $0S 0Nl8P0S5 8R00 0S-0S 9p ႕t(t seh(0 S o 0S 0S, 0S 0QR 00o 8R000'  0S{ 7R00 0R0SV0' RQ00= |7R00 0R0Sm0L'  0S( 07R0$0k, (0Rj0S0' , 0SP 6R00n$ 0Rm0S0& $ 0S, 6R0(00 ,0R0S0h& 0 0S$ L6R0 0( $0R0S0& ( 6 0Q 0d R 0S 0S0s0S0%  k0S5 0R0 00S0S0x%  P4P0S ,6pP ។@%@ d4% 0 S 0S 0S 0S050S0@5p }pdlg40Q@ @P0 Q R 0S) 03P0S- 5pP X@$@ Id4$0 S [ 0S 0S 0Sl 0 3P0S 2P0SH#  R 3R00 R 0R0S0 p3R0,04 00R0S 0S4 ,3R0000S  R8  R70Sq  RH  R0SI  QG Q  R  R  R R h ֓X"X cL" 0 S  $0S0 (0SM ,0S 0zPQ 1R00 0SL0SG0R0 0S? 0Sk 0S 0H2p ᙓx!x cl!0 S \ 0S $0S (0Sd 0:tX)TP$T<lx@ܪP ԩ@بx\d4Х|X(Ԥl ̣dDtH X̡@@@PLH\( TLX\تXh8 dDh\($L0p   b 0 S ` 0S  0S 0Sh 0 (1R00H RQ00ZQ,0 40S RQ(00 0 R RQ00 Ros RQ 00 ( Rj RQ00S  RVv RQ00 $ RQ RsQ$00 , RLu(2p ኒ" {b"(0 S$ ,0S 00S 40S 042p m# ^b300040S "2p4 YD#D JbP#$0 S ` (0S| ,0S 00Sh 0`3p <# -b3, 0R(0 00S0S4 3R0000%3p $  b 40 0R,0 R4 00RL4p` p$p a4p4p $ a$0 S 0SG 0S $0S 00S0SFm0S$ R4 00R0Sc0S~( , Rh50 0R,0<0040S;0S|PPQ00.Q0 R 0S3 0S 0S0S  R6 0R00 0S0S"05 Rn, (0RZ RR0 ,0RB R%0 ,0Rs R=( $0R0S  R6 0R0p 0$0So0S0A0S Q Q Q  R  R0Sl0SR R7$ 0R 0$0(0S0S0>0S $ R]7( 0R$0H(0,0SG0S0 R$ 0Ra R 0R R. 0Ro0SZ$ ( RP8, 0R(0,000S0Sf00S0s0S0?0S0S$9 0R0O00SN0S00S 0RQ"0S9000S0S 9R0 00S0S?0S~0S1d0S400 Sa0S0 S0Su0 S30S2,0( Sg0S(0$ SI*P R2 0R  0S700, Sz0S$0 So0Sm 0 SW0S0 SD;P0S \;R00 0RyR+  E  R;J Q Q 0R]0A-@`@MpPgQdQaQ ^Q[QXQUQRQ OQ$LQ(IQ,FQ0CQ4@QQ@8`T@@6Q TQ/Q 0 AR@ЍлO-P$Mȯ@`H? p0 0S (S X @TS$ X/X  P/   S S CR0C S00 X ᰟ0 ᷠ0S>0 0u. $ЍOX0 00ᜠ0Su00S X>`0 0WH>H.0 X0 00}0SV,0S =0 08=-0 X0 00^0S7(0S `=0 0h=h-0 X0 00?0S$0S <0 0<,0 `jXe0 00 0S 0S h<0 0ێ<,0 AKXF0 000S0S ;00 0弎<,0 ",X'0 000S0S p;0 0坎;+0  X0 00ß0S0S :P0 0~8;8+0 X0 00᤟0S}0S x:0 0_:*0 X0 00ᅟ0S^ 0S 9p0 0@X:X*0 X0 00f0S?0S 90 0!9)0 X0 00G0S 0S 90 0x9x)0 hrXm0 00(0SSo 80 0 NU0 000W00 0QE Q Q  ( )0Ao$ЍOܝ0 000S40S t70 0垍7'0 l0!`0P@ǟ  0  JR$Ѝ0 00ᬞ0 S0 00ᢞ0S{S3,'0C >St00 0S00@60 0Q6&0 60000S,050 0:6&0 60,00S(05`0 0#H6H&0 460(00S0,50 0 5%0 r500y0S$0u40 05%0 [50$0b0S 0^t4|0 0ތd5d%0 DP50 0K0S40G400 0nj5%0 -504040S0030 0尌4$0 4000S0`30 0噌4$0 l4000S03L0 0傌444$0 4000S 020 0k3#0 30 00S0L20 0T3#0 3000S01h0 0=P3P#0 <300?SB [S> 'S0>18 R" x10 0" 0 0 0 00000 00  8 x0d 0P" _0400X^0 000S0S L00 0ԋ1!0 :DU$ܢ tXܠx`lh\ԷpT ԶxP̵HĴtTв"hhܱ8 ܅$TȰ$аlȄhl@LX(X,ЕxDt DȭD (L Tȩ$~0S0,0,0 0LD0D 0 X000-0@-M 0 0@ZP p Z4 0 P蚋)Ѝ0@ Ѝ/#X@-t1<@0TpM 0S*P1P0  0 441 07[00ЍP`Q $Q 0 Ǐ<@ T <@0S S00  00 0 [Ѝ<L0d0  0̊LZU]0@S< HC lTܩ`0@-`pDMN4<= `dHx8lPu@u 8Ĵl0@-`pDM$PEIIII II 0 JDЍLO-$MS @P`H /Nኘ5p0 叙0S (S X $TS5 %別  %   S Sw CRe0CS0 Xh0S ,5,0 0(5%0 `G0  N0S40 0 $ $ЍODX80S l40 0h4h$0 X% 0S? 4@0 0(4($0 0 000S 3 00·  00 0Q Q QzAo$ЍOڗ0000 00ݘ0S0S 020 0嗇2"0 20 0m0 00Ἐ0S0S0_d20 0v2"0 t200L0Y0$HŸ 0  "L$Ѝ0S0110 0H1!0 100` 5! o0t 0 0$l! ^0cXO0S 080 0 1 !0 0 0090S)0S0X00 00 0 +0008$|$ ~܃t@xPo4nD|npy<܀8P(l0@-PR0 M S@PC Ѝ0l 7Y@l  V( (0( , 0 @ D H -0@-M 0 0@VP jp 6V4 0 P兆Ѝ0@ Ѝ/ȦG- @Tp M` `Vs P6 X?X` g@? 0V0S4 0S 0S 0Sv 0S $0SU 2s 2sb 2sP @. 1V 2* s 0s0S~2s 0s0Sxd>0S 2sP 0s0S0>00>`  =00=09V2s 0s0S2s P0s0S=0h=` 0 l= 00`=0VPiaX2hS+0-00h3s 0s0SUm 3s 3s 0s0S3s: 0s0S83s 0s0S3s 80S080<0S0<04s(0@04s)0A04s 0s0SUq 4s 4s 0s0S4s> 0s0S<4s 0s0S4s 0s0S4s 0s0S4s 0s0S4s] 0s0S[4s 0s0S4sx 0s0Sv4s P0S;P0T0S:T0X0S:X0\0S:\0`0S0`0d0 ЍP 0S 0Sz 0S 0SH P 0Sf $0S$ 2sU 2sd 2sUF9``PQ Q 0ۉ @ T ` @V9` ) T9 0R0 0S6 0SP 0SU 9`d لT)T T D9 00 0S1 $0S 2s> 2s 2sz 0s0SP800x8` ᯄ 80080T2s 0s0S2sQ 0s0Sk2sk 0s0SPoP 50`000^P`F `զ`V700S \7` h[T0S 0S 0SvU7`Pt Rd'd CTX7P0 00Sg 0S $0SF 2s 2sS 2s 0s0Sw2s 0s0Sh600<6`   60060GT2s 0s0S2s 0s0S2s 0s0SPU5` & S5"0r$0a 2s % S 2) s 0s0S2s3 0s0S{2s 0s0S4P`40S 2s 0s0SiP40S 2sc 0s0SPDL40S 2sPk ᗃ$ S 2+ sE 0s0S30Sl  H400<40S2sI 0s0S92s| 0s0Se0Sb ]0 3 0030SP20S% 2sPx B# 3S 2, s 0s0ST20S(P2sU@2` !# S 2- s* 0s0S20S 2sP+ " RP0/02s 0s0SM10S 2sPH 8"8 R 2. s40L04s 0s0P%SPPU 0` Ȃ0  10Rm/0G04s 0s0SU_d0`l ᪂0 L D10R4s 0s0SI0 ؘzu'uh̑dLuT,<`\\8@bTq`lqtDpLlЋHnčlnTtmhm<h  pt܃܅P@D؄D8@|$  ȁ~} }(~@~|<~<`~D|LO_{^@{|p|LKKJ\JxZ0zvI .0F04sC 0s0SAU80`d  10010R4s 0s0S/30K04s 0s0SUt0` ́ 2 0020Q4s 0s0S20J04s 0s0SUGh1`| ᧁ 20020Q4s 0s0S10I04s 0s0SU2` ၁$3 00030Q4s 0s0S00H04s 0s0SU2` [ 30030Q4s 0s0S-0E04s 0s0SU03`  5<4 00H40\Q4s 0s0S3|` 4 0040AQ4s@ 0s0S54sF,0D04s 0s0SUv<4`  8500D50Q4su 0s0Ss*0B04s 0s0S UB4` ̀ 50050P4s 0s0S ᴀ6 0060P4s] 0s0S[.0403s 0s0 %S  R 5` 0 6 0060P-0303s 0s0SUP6` m 700(70P3s 0s0S6T` R t70070yP3sj 0s0S53sF,0203s 0s0SUz\7` *8 0080QP3sz 0s0Sx*0003s8 0s0S6UF7`x 8 0080+P3s 0s0S  80080P3s] 0s0S[+0103s 0s0SU8`+0C04s 0s0SU5$9`/050 50M0gUP9` ) O. 9 00 0SG 0S 0S  * O(:$ 0R 0 2sH X*X sO 2( s 2s/ 0s0S2s 0s0S2s 0s0S<P:00/:` :` R EO  @`V 0~ 0S 0S! 0S 0S& 0SR $0S 2sU 2s 2sPV 0s0Sg2sU(;`~. ;Q00 a 0SfP <R00P& $0S 2s) 2sa 2s+ 0s0S2s 2+ so 2sb 2sq 0s0S2sPm$ <R0 0i 2sl0"(0r5 2s7 2* s 2sG 2s: 0s0S|2sP|CU  `=R00 0S =Q0 0 0S $0S1 2s 2s 2) s 2s 2s 0s0S_2sPg 2- s 2s P 2, s 2s0".0rPq"|>r0$0 2s 2s 2sl 0s0SP2sU>`  >R00 0S0 0S 0SP3P2s* 0s0SD?00D?`P2s4Uh?` t?` $~/ N? 0R0f 0SuU?`#2s< 0s0SO2sP2s 2s 0s0ST2sZ 0s0SP2s 0s0SD2sJ 0s0S1P2s 0s0S000So2sPM 0s0SfU0`<P5 0SoU|0`PU`0`2s 0s0S40P2s 0s0S0Pa 0@- PDM`.pL>>>> > > >$>(l?)i?*f?+c?,`?-]?.Z?/W?h>0Q?1N?2K?3H?4E?5B?8><>@9?A6?B3?C0?D-?E*?H'?I$?J!?K?F?G?L?M?P>T>X>\> `>>>g> 0 y?DЍrO-쯟DMS @P`h  B ?p0 0S (S  00S7 \/\  T/   S; 0CnS00 X0 0000CS? 00|  Ќ0  ׍0S?0 0|d. DЍO000X0 00ḍ0S0S `00 00᪍0 S0 00᠍0S0S d0X0 00Ꮝ0 CR\ rTS00\0X0 00z0 CRX rOS00X0X0 00e0 CRtT r S00T0zXu0 00P0 CR_P rS00P0eX`0 00;0 CRJ$r@S00M0PXK0 00&0 CR5$r;S00L0;X60 000 CR $rS00G0&X!0 000 CR $rS00F0X 0 000 CR$r,S00K0X0 00Ҍ0 CR$r'S00J0X0 00Ὄ0 CR$rS00I0X0 00ᨌ0 CR$rS00H0X0 00ᓌ0 CR$rS00E0X0 00~0 CR$rS00D0X0 00i0 CRx$rS00C0~Xy0 00T0 CRc$rS00B0iXd0 00?0 CRN$rS00A0TXO0 00*0 CR9$rS00@0?X:0 000S%<0SO x8x0 0z`7`'0 +X0 000S80SD 70 0z6&0 X0 00ԋ0 CR#rS0050X0 00Ή0 CR#rS0040X0 00᪋0 CR#roS0030X0 00ᕋ0 CR#rjS0020X0 00ဋ0 CR#r%S0010X0 00k0 CRz#r S0000X{0 00V0 CRe"rS00/0kXf0 00A0 CRP"rS00.0VXQ0 00,0 CR;"rS00-0AX<0 000 CR&"rS00,0,X'0 000 CR"rS00+0X0 000 CR"rS00*0X0 00؊0 CR"rS00)0X0 00Ê0 CR"rS00(0X0 00ᮊ0S$0S 20 0iy1!0 X0 00Ꮚ0S 0S `20 0Jyl1l!0 xX0<00 0 0n0S~ 0S 1 0 0)y0 0 0<0wXr0<00 0 0K0S[0S P10 0yt0t 0 a $WL8q,PDp@\X>[xXL>[8X >p[W=[W=p[xWL=Z8W =YV< ZV<YxVL<HY8V <XU;XU;XxU Z(;XT':VT'p:V4T@':WS&9W|S&8\VR%WT`RURPl6Q0P8#SQO5QO",SxQPO X0 00{0S0S 10 06x2"0 dX0 00\0Sl0SQ l20 0x030#0 rE00 0?Q] Q [Q  w# V0[AoDЍO[ 0  <DЍx3 0 0w$4$$0 /$3@0 0wX4X$0 3t0 0w4$0 840 0w4$0 x40 0w4$0 40 0w(5(%0 4D0 0tw\5\%0 85x0 0dw5%0 x50 0Tw5%0 50 0Dw5%0 50 04w,6,&0 86H0 0$w`6`&0 tx6x0 0w6&0 od50 0w6&0 _TP50 0v6&0 OD50 0v,7,'0 ?45H0 0v`7`'0 /$6|0 0v7'0 P60 0v7'0 60 0v7'0 60 0v080(0 7L0 0vd8d(0 P70 0tv8(0 70 0dv8(0 70 0Tv9)0 80 0Dv494)0 P8P0 04vh9h)0 80 0$v9)0 t80 0v9)0 od90 0v:*0 _TP9 0 0u8:8*0 OD9T0 0ul:l*0 ?490 0u30`0d0%0S0:0 0u:*0 :000S$0x:0 0u4;4+0 H;0$00S 0:h0 0u;+0 ;0 00S<00;0 0|u;+0 ;0<00S80;0 0eu<,0 ,<0800S R  R 0 0S00(0S R  R0 0S000S0n`<0 00u<,0 <00[ G-0 $ -( , -8 < 4&X QQU Q    R#  0 0010 S&00 0'0CQ0 S: 0zG0~R( =$0 0t,0< 3$,04(8S$0S,000S0$00$ ,0PGl>($,0 (0048t>.0 Ƅ00>0 0t,?,/0 @?00c(?T0 0~tl?l/0 Sh?0 0nt?/0 ?0 0??0 0Zt?/0 /00 0It  0Np5O-0@-M 0 0@CP  tp C4 0 Pt'tЍ0@ Ѝ/!uP]A-0PphU`Mp R 0SG Dxp0 SQ %S@RQ@@t0P' 00 s7  0D0S47@0S X 7 0R 0 Q 0S0S  h7R00$X700Ѝ(' 00< s,,7  0C0S 0Sw 0Sb 0S 0S9 Ѝ@pQ Q 0mx0P U 0PR{H6p0 psTƟT6 0C<6 0R0J 0S 0SX 0Sa %0( R00S 50p ]s% NC 5R00500 0SD5@0S X  d5R0 0g 0Sm Ѝ4@0S X $5 0R0 QQ4@0SA XM40p s$  C4 0R0e0S<0,40 s|BE PR0 L4R0 0 R} 0S 0S300S40013@0S 3R0 0 $X3@0S3R00Z 0S30 00Sv t3R0 0v2@0SL3 0R0 0S50S20p  r" B2 0R0 R 0RH 20p ~r" oB20 00S0SQ1@0S7 X2R00[ 0S10p, Xr" IB2 0R0* 0S0S 1R0 0 RQ 0V RQ0v 0SL0@0S0Sh100]r R 0R0@0S 1R0 0jP0@0Sd 0R1, 00SW<U hU,UM$ T D 81XTM0tS(L`SX/PSKdTL.4RtJ\- J8Qh8L, PtH\+OHH+OpGX$\0@-`pDM0P{2333 333 3 0 4DЍDO-P$Mȧ@`H7 p0 ł0S (S X 0TS8 X'X  P'   S S CR0CS0 X0 00ᙂ0S 6 00Xq z0 ၂0S60 0?q`& $ЍOX0 00f0S 0S 60 0!q5%0 X0 00G0S0S 50 0q5%0 X0 00(0S0S 500 0p5%0 X0 00 0So0S 40 0p4$0 }j0 000i00 0QW Q QAo$ЍOǀ0S& 30 0p3#0 L90C00ß 0  B5$Ѝ0S0$3l0 0hpT3T#0 !@300 0S02 0 0Qp3#0 2000S0l20 0:p2"0 2000S 020 0#pp2p"0 \20 00S01<0 0 p$2$"0 200h o! 0K(0 0o! 0:X0 000St0S 0P0 0o818!0 o0S0kX0 0 0o0 0 n000X0$T*hD " C(DJB(IB'dIA 'HAH&HT@ @%lG?h%GL?8 %F>$LF>T$E8>$=#= #xD,="(D<-0@-M 0 0@>P @op  ?4 0 Po[oЍ0@ Ѝ/Up J@-H2@0TpM5 0SH 0S'2P =oŸ2 0g? 0RK. S  'o1 0Q?Ѝ0S0 0SU ЍP|`Q ,|Q( 0s@ T 0@S1P n1 0!?0 0R0.00 0S00  0n>aA0 S R.00ЍX0R00 Ѝ0P ;<:<p:h;9X;D9:0@-PDM`p`/Q 0Q / /00/0 0 1DЍ 8(  O-騇0@S , R00R0 Ѝ 6.6$.)-0@-`pDM,P,C-@-"- 0 4.DЍ-O-PM㰓@`@{3 p0 |0S (S X ,TS^ @#@  S+00 0|Q0 |0SB S6 #S" SX0 00|0S0SL00x2 0 0Zk |{X0 00|0S0S000 00p|0S10 0.k! ЍO10 0k1!0 P1d0 0kL1L!0 0=0,c 0  /ЍQ Q  j  t0AoЍOzL0p 0j\  ]0$\,  *xd2x*828**,)<)-0@-M 0 0@%:P jp L:4 0 P kjЍ0@ Ѝ/k 7C-8`sVp Mk @T~ PU- P@U6 %U0 k0@Pl3l mjX3 00L30:@T03000Sf 0Su Ѝ2 Oj2 0020y:@T R RP @R %R0j0@P\2| )jh2 00\20S:@PQ TQP 0 n8` V @8`T1 j1 0,:1001@0S" Y= 1R0010 0 Ѝd!0) R00S 1D i4!4 9 1R00 Ѝ80 i9D<@`T8(X0 i  90 0R0D0S  0 L//'x 0/D'/8..& -&-$, t-`%8 %,$0@-`pDM8P,**** ** 0 +DЍ#O-P$M@`Hxy6 p0 |z0S (S X 8TS8 %娥  %   S Sy CR0CS!0 X0 00Pz0S 05 00i W1y0 8z0S40 0h$ $ЍO;X0 00z0S0S X4`0 0hH4H$0 X0 00y0S 0Sn 30 0h3#0 00 0yQ Q Q~Ao$ЍOx0 00y00S& 380 0h 3 #0 w0 ;08:Ÿ  0  7-$Ѝ0S0\l20 0]h2"0 p200I0S 0E2P0 0Fh828"0 $20 020S0.10 0/h1!0 t100h h! c0p(0 0 ht! R0_X0 001y0S0S 00 0g1!0 10S0X00 0g0 0 000 $0 G" !\p)p! ) <(0 'h<@'( & xH%P%pT-0@-M 0 0@7P qgp =74 0 PggЍ0@ Ѝ/h*O-@oT`TM 8PU t0SP: 0SXϟ U pxP\p  0<1SΟ LU pP\p  0P1SYU Tt.t> 0Q@!D1 \1So d1SS l1SV |Pw5Sj0%5R%WRU S*h?0 0 g0 =0575S05 %R:5S05 %R:5S05 S5S 4S 4S TЍT1SF \1S d1SU' =0d1l1S@10SD10Sh!d1p!l1R5U d!<R0\1%Rl,%%R /9|1S DC CR C  :f!S  /Rl 9 ep8 0P5\T80,0(0i+R\  0f0 0P 0/S 0v>C CR C  e!S /Rx 8 ae7 0P5e000S \ਅe0 S 5 R2 $08 9e 0Pf5+ 5 # *R! *R`!7 e6 0PI5e@X7h  eP6 0P55먅86 0$0 0$&$6 0l!p16044S 504TЍ505PpQ Q 0i@ T 8P@UU pşH |d dP5 00D504t0S 0 3Uo <@D H0LPT U \!4R0T1 d1Sa@5 dtt4 044P rd<<4 044 ad4 003043#0D1T1 S@! \1S d1S Ddß3 0n4d p|S` +dLßL3 0U4P3(0 0dß3 P0A4!L30 0d0  20.430 0c0  |2042d cP3Dh680@S) p$ŸP |<2 c1 031d!0R\1h1 c1 031\!0RT1Oд(##:0x%%!T!!@!h!!t" $TH`XP9(l`8\P4 l66pDHl`<44 `| 4l  LX 1  /x ` 0 0C 0c0 X 0:S5 0  Q RRQR  d0 6Q06Q0 0 b1 0P&35 0tꨅ 0 0C0uc!Sx :Rp%0 0 QP  PPQs d06Q0iz6Q0c 1 b2 0P2Q42`t0SP0 pTP0O-PTMw pK#`EQ#Vf8p`TQ#Wft`pQ#Ztذ BoQ #[@#D#TQQ #\Q #dQw #lQo #\$|1S t1 #|1 Sa$QW #QO #B$tg ˟Q # [H$Q8 #Q0 {#|#&$|!RA 5 #5 0#5 0~#5 0 y#5 0t#5 0o#5 0j#5 0e#5 0 E#5 0$@#5 0(#5 0,#|1 S0#4 PP Q # U P弣p Q # XԀ Q #WtNQ#VHQ #LQ #XQ {#`Q v#hQ q#pQ l#Q g#Qy b##rKnp `QW# V#Qb N#QZ I#R#"L#I#F#C#"".#0"ԁ}Onp`Q"WR~ Q #X|Un p `Q"VPq]p PQ"V(!0 #TЍ zrjbZRJ|\(H0<@4(|pO- 0P40=`0,0=000,0 000 0  0Wq0 RLp W 0 0  0Iq0SP S0S R`> , `00 W =0,0=0pW 0lO>0P40<`0,0<000,0 000 0  0q0 R7p W 0 0  0q0S, S`0S RL= , _00  <0,0<00SQ0 0  0p0S< 04S^  <P _;+0 60S00 0  0p0S 05SS  <<8P w_$;$+0 0S0 0  0p0S 05SO0 50S0 0  0p0S 05SJ0 50S0 0  0rp0S 05SE0 5`V* 0 , )y? P#p1 000 0 0Np0S!`dV 0 0  0@p0S S0S R<: , ^00 N(901 900S0 0  0p0Sx 01S  9P ^8(0 (r0Sl0 0  0o0SW 01S  ,9TP ^@8@(0 Q0SK0 0  0o0S6 01SM  8P ^7'0 00S*0 0  0o0S 01S!  $8dP q^P7P'0 0S  P%0S 0S |t0t|01x0|1x|   0  {o0 R S0 0  0no0`S 0S0 0  0_o0S 0l1S  6P ^5%0 mpW 0Q_0 0  0 Sz Y9)0 .iS  R. 4! R0d)P SV0 0  0j0S SJ Y:*0 iS - 4! R0$*P S&0 0  0j0S S0 zY@;@+0 iy h g!p40R0Sj Rg l1 0p10S. R+ 1 010S  R  1 010S R 4 040S R \1 0`10S R 5 050S R 1 010Sb R_ T1 0X10S@ R= d1 0h10S R 1 01< PP Xd=d-0 @x= 0l1=0p1< P X=-0 )= 01=01lL= P X=-0 > 0d1>0h1U= (P X<><.0 P> 0T1\>0X1>> pP X>.0 > 01>01'`> P yX>.0 > 05>05> P bX?/0 (? 0\14?0`1? HP KX\?\/0 p? 04|?04t? P 4X?/0 ? 01?01? P X?/0 q? 01H601 868P X$6$&0 Z 5P W5%0 J 5P W5%0 :|5 P `W5%0 ) 0ll%t04 1S0 0S 4 0P `W5%0 0%R> 04 1S0 0S x4 P `W4$0 0$=04 1S0 0S 3 PP `sW848$0 0  $04 1S0 0S[ nt3 P `SW3#0 0#804 1S  Rw 2 xP p3W`3`#0  0HH#a 0V 0S< x2 P` W2"0 h" 01 W@H!0 DL!S T VP. VG 1dP V;@ V20X!00 0V! "0 CP@  RP@ O OP@  RP@  ,%X V8 V V Vvh Px|48DTx00<Ht,0<p0<D lH0S R 0@/// 0R://p@-q@P`M& 0*Vp MV"0(,0  Ca0@s 2c0 @0@@h 0 W0( @00, 0Ѝp0A-!  p@` ^! R0P! P1 S S0T! 1^!2/~$ : 0p` 1\!2/ R0!1 S S0T!\!| \ NE0A/0Vl0ll.0VX0XXX 0VH0HHH 0Vn<xX8hO-,M 03 0`@$00Tp0]Rp 0F0C Sk0V`T R~(PHz(T@A4 R x;_UPPB@@AAQJ 2/R 10   UP  1 PR R R x R: PB@AQ R  0R7`p; R B @APQ0qx@ R0 S 0S 01x@6o`,ЍS 0S 01x@` }00@T @0l 0 0U$0 0@0@0  0T 0 Ul XTO- M'7 # 0`p@W 'UP&00M-00pM 0s 3 Tǟ_K  0010 0 T 60TP,( ,0Q0P,U 0 0 00(bT000(0@00s  (0  0TpP K3u`p0S8T&0S\2=PX`K& 0RQ %3\  R  12/hT0d"S\2a 3?02/!T2P3?0001S01HD10Q12Ͽ 3?P2 2?L2 01<!12?0X D @2 &08S : P<0&0S @:?8 82 `" T" H" <" mT0S8 KTp 8P 1 0SP?K0?K0/K.>K{P2 {0Sp 0 SP&22 2\2 22 03?002 2  011CРQȂ ̢ R  @ \0 S R 0 S 3?! ℁0R 0@B B2  0WT Tآ G n?K3 ?K3 q?K3 ?K 3 S  @S Z @ PR 2 1  Z P@2"S001 0  PC S2/0#P 2"0S2 Si'Tp  SP0s PS TK KSQ 0S R 0Sw3?P`0S00102/3?00#   \ 0@L \2  R  P<di$p(d@<D d"T01P"\H1D"Q1D X2 0L2 1<P @2 0 00R0;K?K 3 0d"p0  0mS_S0 @R 00oR R$1@0P R0 @Rp \1R0 @~R 1R10@ 2 DR 3RR10 @2 R0 @ZR 2R0 @PR< <2R0 @FR` d2O-O OM@P  < DA 4! R?8 0 ,1 0! S,0!3?01 0K4 @1 R41PK@  Q 0  Q0 04? 0R 04,0S ` p  pr0C2 p \@41$ `00M4Qp pcR@0$a @ T P X$ ` Q@  T0 P4A H 01 0 L $1SA!Y 001 HP0A1 0A S[,1Up1P40W`3o1 $@F$0 1 1QQW1 `1  p:oV  oQP 1W@1S1@D1QQ`Vp01001 1 0 Y1 HL8! 0< H@P ,1!0S004  03?02/!1"b1Rj:0SL (<( 01 41`@  P A  ` V P $1SV` P@T00 0@Qqp  $ 1! QR00V00S 410P ! 0.>0 S01p @guQ0S+ Qp  w0QP ! 01 1 a  `0 VQQ pQpp `@  aTZ@101 10 1 0E SKT@,1 1R4p! 7#@G#! 1R0] P @Wl0P,! R ! 21003?03?!00G 1@13?S@D1QQ 1W01 1! 03?1W$1(q  0* 01P 0PP 0l Q 0!1100 3?PSK 1@13?T* 0 P0 0l QP QlpW0  0Q 0!1100 PS 1@1S1@D1QQ` 1@(qS 0!110W 0 1 0V*`S6* K P`P70lpSh001 O `a`f `` !G00 0Op !l0 0,1p0W1 1  1 O?o2S=1401 >1p: 1 `,10S1:01 1`"00 1p OV PD50 1 qO   {O`iO?o,!2Sp 0@!W3? 1 1 0V*`S:1p$!Q9 Y H Q9 ! 0!01"b1R{:0S1( $0Rs !80 00Sk! 0 111`P @T*1Q @W1P @T:@D$!R6` V P A(@$4\2 200 R,10S0L S1 02/3?H 1000{  a-1( $0R 1 81102/0R :! 0 3?1112/!"bR* A 04!< K l !$ VODX2 0<N  NS>1!0 !<81P N,10S 0x 2/13?P1 5?02? 00/o"R ! 3?0P`$@11` $003?0Ġ3?0/0 !o \U `!"!0 !$0@1C0P 0 V23Ͽ  0U 0V0 K0/o" Kza00M N NP111 01 9 _tX 8  0 00 o ! \ `R B !"! 0N 0D@01 M 7N{N3xN 0rN 0O- MĒ00 P`" 'Q Q   l\@* <Ͽ\: 1<Ͽ  l\:S0 2/  0pM0 R0  12/ 2/0 8/ 0/  R 2/1A16o` ЍR `      RA` Ѝ0 0 @0@@@ 0.N00000 0&NN8`O--([MⰣ3x 0`p W PM&00PM0U@|1 ( p&ҋp8 0LPMIMp@a CKMPV8 0Lp8 KLp !0RP!0RP]M0S!8 QKLp 8P\"D1 RL"3?S@ 8 0L@P3 AM 2 0 @x1 M200 SO?KM10?2c"c11@0"c#b13QK<1 LM|1pWUV |1x!00@0(Kx1PU Y?K|1 o L00M uL 10 Lp@4 0 p0@a S00D1 8038a <1 e0 S<1iϠ1u, | 01 04 }$ ! (  ,1 1 1 M | R!02/` J  Mb0 L0Se8 QKLp 8P|1,1a 0L0P|1 >K0Z?K0]/K[?K{l1 {@0Kpp  Lp` LiLp x|!t1h!p p! ` 0(K KPDß|Q  0010 03?1u, | Ÿ013?2/r` K30 K K7LP8 0@K2P 0pK KYKP@L KTm|xh@x1 42 0xQ>K @0Z?K]/K0[?K1pV`l1  `0@aKp xth!p1!K d10@x1 AK0 KKX1,0 @x1 KP8 0@(K1P 0 @x1 00 @x1 K 0 fK0 0{@0K l|00r @'KP X0 LȻ0T<8Lܺ`̸L`  @ K$ 0`.40@0 J0 #KgKl p00s/0- MP0K0 ЍKO-\ X* R 00^  R ^ R 0 Y 2/1[*1 0 86 03EU[ PD U00s @PD<4D04ED 00 PR3? 04 ,04p^3? 7^ Y&Q ( WQ0W$Q  000013?U(*01 P4 0D[ 4q0p4`6K  Q O XF VQ<ϿU  001@\* R3#0DQ <Ͽ [08 3?2/0 R: Q XQ  V8 0 0R: Q Q B VQ0Y@200200200$ @0p0 ` 04[Y \0t <Ͽ\w801/3?0 R_U @ 0@@AP6::[ 1 P 0S #C0  0CZ0W 10!p C W` 0$ 0 0S000? 4 Bp`0S@0C 0\ \ 80 0R U @U U @[01+U @U @ 01 B00p0ppp 0C`0``` 0C )\H$d؛0AS>p@-Q`M( A@0 0P0 000 S`Qc`1\ @0~CP0 RЍpЍp0AS0< 0 0( 0 0 `/Ἧv4-0@-M 0 0@P )Bp 4 0 PBDBЍ0@ Ѝ/>CĕO- M`B00M@ P  6B U:R 0r/S  U@BV0T/S @DU:O AKDBPH0: SDjB`P@ @D@D01  BpP. 0.S0S 0.S0.S0S yBq pA/001 0 1 )BKBP0* R ABpPBX1q K K| Qx Q S 1RP 0 1 p  Q *0 0C1 180S080/0/@-0B(O- 4M\7`080 0pS@ 00  08QPP 78  7040 0   R@T$ T T:T40@D>T4@ 'T T<&T*0   xR0S000S aQ4Q 00 0 K?T [T @ o 00 % 0(0 08 50 <0 A7QT0   ;R0S0S0T000J o 00 * 0(0 0K o 00 B 0(0 0uK o 00 y 0(0 0gL o 00 _ 0(0 0YL o 00  0(0 0K@ o 00  0倀(0 0= @ o 00 ( 0 (0 0/@ o 00  0(0 0!@ o 00  0(0 0@ o 00 | 0(0 0  00 : 0 0( 0T 0/S K28 0000 @P(  0SB@/ 0Ÿ0 M  0 }@LOPPР8 2(0 <0 !@Tn " @P8 10 <0 8 10 <0 4 @ @P  M0<0 @000M @<?\Q@ D` TTa( P< `Hp (KZ@pP3 ?    @OP ?/00@OP <@D`HpP4L00M0 00 ?00s`  D`KHp@4_,$ $_$ȒY0 Q: >000 Ѝ0 0>0p@-8 0@RPM`C00 \:S(  (  00\ 01 0 0>000Ѝp > 080p@-S@`!?P 0R: >000p >p@-@ 0 B 0CRPM00?80Sh001S05_ Q :P000Ѝp  n>  h>06A-P@0@D@0CTp`!00 >80S 1R:!;>`001!S V023?Q0 4> />5@-@M> Ѝ@@-8 0R@M`0 Q@Ѝ 0 >0 @Ѝ80S080/0@- 0>pT80@-SS080 Q *0 0C1 180S8088/0>$0$$$ 0>̈x80S080/0/@-0>0D80S080/0/@-0>ԊO-P H\@OM'Qp` QU !PP@$T4 4^1`D 8 @ ^ !8`<0P 0< W p Wzx` P` $ @U: W1!(``PPEUO  ;@PI o<0S P(`X\(`$`PPEUN   ;@PH W<0S P(`XD $;P>PE@`; << .<& p;0!   L<P P;{P(`@I  p0P,@; ;P `z; x;n$0P@I(`0@`l; Pk:Ѝ0@ Ѝ/8;uO-P. KM BKQ :~@Pp @ KI0Py 8 ` : l.  `>! 001':00 1 8 Pl0$1 1 P, PP=@( q 0   K 0R Xqp@`T  DR R@ `p  RZ R !P=P0 98p 9 ] I0   J 0R pR/1:Pv 9P   0Sr:  /0`|̟0  00 19<@I0`v9VUJq9 KR@qDo I _I+ :@P @0;0 1 N9+ 0   xJ0Sm0Sa ! ;D0 ,1 29T +  QI0   XJ@`T0B `qXZX :0@Tx:0 1 9 06 U  R* R p,1 9P ,1pR: 8 0000 PS,  ,  00 R !0   JpWF 0GSi`9Wpp !49h0 8P 8   X4!  , 49p09W,1pG01 , 9(1S,01 Uࠃࠓ " 8A @( , $   ! " ğb( #! ğ 0 0#<@ 0@`ğc> "  Dğ  ! "$@ (ğb( #!,@  ğ 0 0# 0ßc> " ß  ! "4 ßb( #! @ ß 0 0# 0ßc> @"@$@J0hß ! .L#n  #,0#Ď     c` 0`` !Ba@@ " B(0@ @0#05@b` `@$@dM.$`xn,Ȏ  1a0 1000000 0 0sG-@pT`PM3?U-@U @A0E#300@  @T 0 @ T =j@PE@`ScF@ @2?T@ЍUЍ0dS!1 2 0@S0 ` PE @@@D \2 ?00??  2A-@p0`M`0`0P @@@000@#T00007P@p@p@x `8 `w20qA010    Ѝܺ#EgvT2Pq@-x1@0Mp20P p`2P0: S B3Ѝ3P 1$001@00 a2P2 $ 2P* $h2P%$c2 P $1P$Y2P|0 0 $ 2P $2 3381$2 22,` `0$S@- MpH2PP' k@Pm2PP 00S/S``0] p10/S  `   ЍK`p/  Y2,@ 1 0@P^@-`|M2@P6 0P.S0S 0.S0.S0S #20 00Rp &:110PS S @6 : SW@ 0G 0.R W pG0p.S |ЍG1P00h1 0 R0!00 0 gR zR  0 bS0zS02S00p@-@0PA1 ?1=1p@?2pH- MP`1@1T 0 S00/R000M  71  @/R11P2P Kp M @!1/00P0P0P000000L$[[[[C-M M@PC p` j10P(  00P+  0P$  0P 0P T1P 0PA10P y1W 01ڍ Ѝ>0`1p``ڍ Ѝ<[[p<00P/p@-PP @0Pp@0p@- 10P`S1@P |M1P `0@pP  0D=1P `(  0  0Y|YhY0P/- M0#1P0  ЍJ0  00 Y-00@-0 MR 0S Ѝ0@ Ѝ/ 0 P@ 0p T 0P  0@ 00Ѝ0@ Ѝ/ 0 e01XHX-0p@-0 @ TM  Ѝp@Ѝ/0P0m` /p V 0P /L0L0 s0/Ѝp@Ѝ/ 0 *00W\W -0p@-0  M 0P0\0SЍp@Ѝ/0`0P-@ /p T$ 0 //0VA- @0M PS\Ѝ,0p` 0P(@ [/p '40 00 0 /u/r08VG- pP @1!1R W I`IV @ @D01!1W R X W/P R M/PO- M0 1 1 4R 0  0 ! 1!2cSp11p3: ЍAQp W` @P2WP`1Q@p0p00Y@P  `VPY@* ЍO.p0`  s 0  0'GꫪQ 0@ S P//C-ԐMp W` @P&WP`Q@pQ @p@@0P  H0 0 .Ѝ0'G@-@ ..C-`RPpM: @F0ASKT@@ 0  11S% 0R: b.P80 080(0 \! ЍT.@p@-RP` @M B A0\^0 1AS 00Ѝpp@-RP` @M B A0\^0 1AS `Ѝp\ \   0 /P/A-p W` @PWP`Q@pQ 0'Gꫪ-@-h0M0  @ -P Ѝ@Ѝ/,0,0 0- - N@-l0P0@M.P Ѝ@ @0 < 0 @- -0 lN@-@-P@@-@:-P@P@-@ -P@-P- M- Ѝ- Q/t:Pkl ?o/o0B0s0  P @ P @ P @ P @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ ///o b0/PQ @-@A/Q  aB Qp 00`BSoq /oo @ r  S?C S?C S>C S>C S=C  S=C SA AA'A6AAAAAA&AA)AAA A A2.42(crosstool-NG 1.28.0) localedef %s%s Copyright (C) %s Free Software Foundation, Inc. This is free software; see the source for copying conditions. There is NO warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. 2024Written by %s. Ulrich Drepperascii,For bug reporting instructions, please see: %s. System's directory for character maps : %s repertoire maps: %s locale path : %s %s/usr/lib/locale:/usr/share/i18n/usr/share/i18n/repertoiremaps/usr/share/i18n/charmaps/dev/stdinPOSIXLY_CORRECT/usr/lib/locale%s%s/%s/%s%s/%.*s%s%s/%s/cannot create output path '%s': %sno write permission to output path '%s': %scannot create directory for output filesFATAL: system does not define `_POSIX2_LOCALEDEF'cannot open locale definition file `%s'cannot write output files to `%s'no output file produced because errors were issued%s%.*sisoprograms/localedef.cgenerate == 1circular dependencies between locale definitionscannot add already read locale `%s' a second timeadd_to_readlistNAME [--add-to-archive|--delete-from-archive] FILE... --list-archive [FILE]Compile locale specificationInput Files:charmapSymbolic character names defined in FILEinputfileSource definitions are found in FILErepertoire-mapFILE contains mapping from symbolic names to UCS4 valuesOutput control:forceCreate output even if warning messages were issuedno-hard-linksDo not create hard links between installed localesOptional output file prefixposixStrictly conform to POSIXquietSuppress warnings and information messagesverbosePrint more messagesno-warningsComma-separated list of warnings to disable; supported warnings are: ascii, intcurrsymwarningsComma-separated list of warnings to enable; supported warnings are: ascii, intcurrsymArchive control:no-archiveDon't add new data to archiveadd-to-archiveAdd locales named by parameters to archivereplaceReplace existing archive contentdelete-from-archiveRemove locales named by parameters from archivelist-archiveList content of archivealias-filelocale.alias file to consult when making archivelittle-endianGenerate little-endian outputbig-endianGenerate big-endian outputmb_cur_minmb_cur_maxescape_charcomment_charWIDTHWIDTH_VARIABLECHARMAP%s: must be greater than syntax error in prolog: %sinvalid definitioncharacter sets with locking states are not supportedbad argumentduplicate definition of <%s>value of <%s> must be greater or equal than the value of <%s>argument to <%s> must be a single characterprograms/charmap.c! "Should not happen"syntax error in %s definition: %sno symbolic name givenU%08Xinvalid encoding giventoo few bytes in character encodingtoo many bytes in character encodinginvalid names for character rangehexadecimal range format should use only capital characters<%s> and <%s> are invalid names for rangeupper limit in range is smaller than lower limit%.*s%0*d%.*s%0*Xresulting bytes for range not representable.no symbolic name given for end of range%1$s: definition does not end with `END %1$s'only WIDTH definitions are allowed to follow the CHARMAP definitionvalue for %s must be an integerWIDTH_DEFAULTunknown character `%s'number of bytes for byte sequence of beginning and end of range not the same: %d vs %dvalue for <%s> must be 1 or greater%s: premature end of fileI18NPATH/charmaps:ANSI_X3.4-1968default character map file `%s' not foundcharacter map `%s' is not ASCII compatible, locale not ISO C compliant [--no-warnings=ascii]parse_charmapABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#%&'()*+,-./:;<=>?[\]^_{|}~ ENDescseqincludecode_set_nameaddsetg3escg2escg1escg0escprograms/linereader.cseq != NULL0x%02x0x%02x 0x%02x0x%02x 0x%02x 0x%02x0x%02x 0x%02x 0x%02x 0x%02xinvalid UTF-8 sequence %srmtrailing garbage at end of linegarbage at end of character code specification...(2).....(2)..unterminated symbolic namegarbage at end of numberillegal 8-bit character in untranslated stringillegal escape sequence at end of stringunterminated stringillegal 8-bit escape sequencesymbol `%.*s' not in charmapsymbol `%.*s' not in repertoire mapinvalid escape sequencetranslate_unicode_codepointlang_ablang_termNo definition for %s category foundLC_ADDRESS%s: field `%s' not definedpostal_fmt%a%N%f%N%d%N%b%N%s %h %e %r%N%C-%z %T%N%c%N%s: field `%s' must not be emptynafdbshNtreClzTSc%%s: invalid escape `%%%c' sequence in field `%s'country_namecountry_postcountry_carcountry_isbnlang_name%s: field `%s' must not be defined%s: `%s' value does not match `%s' valuelang_lib country_numcountry_ab2country_ab3 %s: numeric country code `%d' not valid%s: language abbreviation `%s' not defined%s: terminology language code `%s' not defined%s: field `%s' declared more than once%s: unknown character in field `%s'%ld%s: incomplete `END' line%s: syntax errorprograms/ld-collate.ccollate->cursor->next == NULLcollate->cursor->last == NULL`%.*s' already defined in charmap`%.*s' already defined in repertoire`%.*s' already defined as collating symbol`%.*s' already defined as collating element%s: `forward' and `backward' are mutually excluding each otherLC_COLLATE%s: `%s' mentioned more than once in definition of weight %dforwardbackwardposition%s: too many rules; first entry only had %d%s: not enough sorting rules%s: nested conditionals not supported%s: more than one 'else'collate->cursor == NULL%s: empty weight string not allowed%s: weights must use the same ellipsis symbol as the name%s: too many values! "Internal error"symstr == NULL || endp != NULLstartp == NULL || startp->wcs == NULL || startp->wcs[1] == 0endp == NULL || endp->wcs == NULL || endp->wcs[1] == 0%s: byte sequences of first and last character must have the same length%s: byte sequence of first character of range is not lower than that of the last characterseq->name != NULL%s: symbolic range ellipsis must not be directly followed by `order_end'`%s' and `%.*s' are not valid names for symbolic range%s: order for `%.*s' already defined at %s:%zu%s: `%s' must be a characterLOCFILE_ALIGNED_P (obstack_object_size (obstack))nrules <= sizeof (runp->used_in_level) * 8%s: `position' must be used for a specific level in all sections or nonesymbol `%s' not definedsymbol `%s' has the same encoding assymbol `%s'too many errors; giving upruleidx <= 128LOCFILE_ALIGNED_P (obstack_object_size (&extrapool))runp->nmbs <= 256runp->nwcs > 0idx != start_idxelifndefelseelifdef%s: duplicate definition of `%s'col_weight_max%s: unknown character in collating symbol name%.*s%.*lX%.*s%.*lu%s: unknown character in equivalent definition name%s: unknown character in equivalent definition value%s: unknown symbol `%s' in equivalent definitionerror while adding equivalent collating symbol%s: unknown section name `%.*s'%s: multiple order definitions for section `%s'%s: invalid number of sorting rules%s: multiple order definitions for unnamed section%s: missing `order_end' keyword%s: order for collating symbol %.*s not yet defined%s: order for collating element %.*s not yet defined%s: cannot reorder after %.*s: symbol not known%s: missing `reorder-end' keyword%s: section `%.*s' not known%s: bad symbol <%.*s>%s: cannot have `%s' as end of ellipsis rangeUNDEFINED%s: empty category description not allowed%s: missing `reorder-sections-end' keywordcollate->else_action == else_none%s: '%s' without matching 'ifdef' or 'ifndef'%s: 'endif' without matching 'ifdef' or 'ifndef'%s: duplicate declaration of section `%s'duplicate definition of script `%s'handle_ellipsisinsert_weightsunlink_elementinsert_valuecollate_readobstack_int32_growobstack_int32_grow_fastadd_to_tablewccollate_outputcollate_finish%s: transliteration data from locale `%s' not availableLC_CTYPEprograms/ld-ctype.cother_ctype->translit_include == NULLcharacter class `%s' already definedimplementation limit: no more than %Zd character classes allowedcharacter map `%s' already definedimplementation limit: no more than %d character maps allowedupperloweralphadigitxdigitprintgraphblankcntrlpunctalnumtouppertolower%s: character `%s' not defined while needed as default value%s: character `%s' in charmap not representable with one byte%s: table for class "%s": %lu bytes%s: table for map "%s": %lu bytes%s: table for width: %lu bytesNo character set name specified in charmap//UNKNOWN//SPU00000020form-feedU0000000CnewlineU0000000Acarriage-returnU0000000DtabU00000009vertical-tabU0000000B%s: character `%s' needed as default value not representable with one byte%s: field `%s' does not contain exactly ten entriesoutdigitno output digits defined and none of the standard names in the charmapcharacter L'\u%0*x' in class `%s' must be in class `%s'character L'\u%0*x' in class `%s' must not be in class `%s'internal error in %s, line %u\%zocharacter '%s' in class `%s' must be in class `%s'character '%s' in class `%s' must not be in class `%s' character not in class `%s' character must not be in class `%s'character not defined in character mapctype->mbdigits_act == ctype->wcdigits_act`digit' category has not entries in groups of tenno input digits defined and none of the standard names in the charmapnot all characters used in `outdigit' are available in the charmapnot all characters used in `outdigit' are available in the repertoirenr < ctype->map_collection_nrlocale != NULL%s: syntax error in definition of new character class%s: syntax error in definition of new character mapellipsis range must be marked by two operands of same typewith symbolic name range values the absolute ellipsis `...' must not be usedlast_str != NULL%.*s%0*ld%.*s%0*lXwith UCS range values one must use the hexadecimal symbolic ellipsis `..'to-value of range is smaller than from-value U%04Xlast_token == tok_charcodewith character code range values one must use the absolute ellipsis `...'start and end character sequence of range must have the same lengthto-value character sequence is smaller than from-value sequenceduplicated definition for mapping `%s'%s: `translit_start' section does not end with `translit_end'%s: duplicate `default_missing' definitionprevious definition was here%s: no representable `default_missing' definition foundpremature end of `translit_ignore' definitioninvalid character namecharclass_symbolic_ellipsisctype_readfind_translittranslit_flattenctype_outputctype_finish0123456789U00000030U00000031U00000032U00000033U00000034U00000035U00000036U00000037U00000038U00000039onetwothreefourfivesixseveneightnineLC_IDENTIFICATIONtitlesourceaddresscontactemailtelfaxlanguageterritoryaudienceapplicationabbreviationrevisiondate%s: no identification for category `%s'posix:1993i18n:2004i18n:2012%s: unknown standard `%s' for category `%s'%s: duplicate category version definitionLC_NUMERICLC_TIMELC_MONETARYLC_ALLLC_PAPERLC_NAMELC_TELEPHONELC_MEASUREMENTmeasurement%s: invalid value for field `%s'%s: field `%s' undefinedyesexpr^[yY]noexpr%s: value for field `%s' must not be an empty string%s: no correct regular expression for field `%s': %s^[nN]yesstrnostr%s: value of field `int_curr_symbol' has wrong length%s: field `%s' not defined, using defaultsmon_decimal_point.%s: value of field `int_curr_symbol' does not correspond to a valid name in ISO 4217 [--no-warnings=intcurrsym]mon_thousands_sepmon_groupingpositive_signnegative_sign%s: value for field `%s' must be in range %d...%dduo_p_cs_precedesduo_p_sep_by_spaceduo_n_cs_precedesduo_n_sep_by_spaceduo_int_p_cs_precedesduo_int_p_sep_by_spaceduo_int_n_cs_precedesduo_int_n_sep_by_spaceduo_p_sign_posnduo_n_sign_posnduo_int_p_sign_posnduo_int_n_sign_posnduo_int_curr_symbolduo_currency_symbol%s: value for field `%s' must be a single characterduo_int_frac_digitsduo_frac_digitsuno_valid_fromuno_valid_toduo_valid_fromduo_valid_to%s: `-1' must be last entry in `%s' field%s: values for field `%s' must be smaller than 127conversion rate value cannot be zeroAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYRBZDCADCDFCHFCLPCNYCOPCRCCUPCVECYPCZKDJFDKKDOPDZDEEKEGPERNETBEURFJDFKPGBPGELGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSINRIQDIRRISKJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLTLLVLLYDMADMDLMGAMKDMMKMNTMOPMROMTLMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSVCSYPSZLTHBTJSTMMTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVEFVNDVUVWSTXAFXCDXDRXOFXPFYERZARZMWZWDname_fmt%p%t%g%t%m%t%fdfFgGlomMpsSt%s: invalid escape sequence in field `%s'name_genname_mrname_mrsname_missname_msheightwidthtel_int_fmt+%c %a%t%laAcCelttel_dom_fmtint_selectint_prefixabmonAMPMam_pm%a %b %e %H:%M:%S %Y%m/%d/%y%H:%M:%S%I:%M:%S %p%s: direction flag in string %Zd in `era' field is not '+' nor '-'%s: direction flag in string %Zd in `era' field is not a single character%s: invalid number for offset in string %Zd in `era' field%s: garbage at end of offset value in string %Zd in `era' field%s: garbage at end of starting date in string %Zd in `era' field %s: invalid starting date in string %Zd in `era' field%s: starting date is invalid in string %Zd in `era' field%s: garbage at end of stopping date in string %Zd in `era' field%s: invalid stopping date in string %Zd in `era' field%s: missing era name in string %Zd in `era' field%s: missing era format in string %Zd in `era' field%s: third operand for value of field `%s' must not be larger than %dweek%s: values for field `%s' must not be larger than %dfirst_weekdayfirst_workdaycal_direction%a %b %e %H:%M:%S %Z %Yabday%s: too few values for field `%s'extra trailing semicolon%s: too many values for field `%s'alt_digitsalt_monab_alt_monerat_fmt_ampmera_yearera_d_t_fmtera_d_fmtera_t_fmttimezonedate_fmtJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberJanFebMarAprJunJulAugSepOctNovDecSundayMondayTuesdayWednesdayThursdayFridaySaturdaySunMonTueWedThuFriSatprograms/locarchive.calign_adjust < RESERVE_MMAP_SIZEstart_a != (uint32_t)-1end_a != 0start_b != (uint32_t)-1end_b != 0locale '%s' already existshash collision (%u) %s, %s/usr/lib/locale/locale-archive.XXXXXXcannot map locale archive filecannot create temporary file: %sname: size: %u, used: %d, new: size: %u cannot initialize archive filecannot resize archive filecannot map archive headercannot lock new archivecannot extend locale archive filecannot change mode of resized locale archivecannot rename new archivecannot read data from locale archivecannot add to locale archiveGET (namehashent->name_offset) != 0GET (namehashent->locrec_offset) != 0failed to create new locale archivecannot change mode of new locale archivecannot open locale archive "%s"cannot stat locale archive "%s"cannot lock locale archive "%s"cannot unlock archive headercannot read archive headerbad magic value in archive header@%s%s%s.%s%s%slocale alias file `%s' not foundAdding %s stat of "%s" failed: %s: ignored"%s" is no directory; ignoredcannot open directory "%s": %s: ignored/SYS_incomplete set of locale files in "%s"cannot read all files in "%s": ignoredlocale "%s" not in archiveused < GET (head->namehash_used)sumused < GET (head->sumhash_used)data != NULL%6d %7x %3d%c %02x%02x%02x%02xLC_MESSAGES/SYS_LC_MESSAGES %s/%s show_archive_contentadd_aliasoldlocrecentcmpprepare_address_spaceprograms/locfile.cfile->next_element < file->n_elements/locales//usr/share/i18n/localesargument to `%s' must be a single charactersyntax error: not inside a locale definition sectionfile->structure_stage == 0file->structure_stage == 2file->structure_stage == 3file->n_elements == file->next_element%s%s%1$s%2$s/SYS_%2$scannot open output file `%s' for category `%s'failure while writing data for category `%s'cannot create output file `%s' for category `%s'.tmpexpecting string argument for `copy'locale name should consist only of portable charactersno other keyword shall be specified when `copy' is used`%1$s' definition does not end with `END %1$s'write_locale_dataend_locale_preludestart_locale_preludeend_locale_structurestart_locale_structurerecord_offsetIGNOREdefinetranslit_ignoretranslit_starttranslit_endreorder-endreorder-sections-afterreorder-sections-endrepertoiremapcharclassscriptcharconvsection-symbolcopyorder_endreorder-aftersymbol-equivalencecodepoint_collationcoll_weight_maxcategoryconversion_rateorder_startdefault_missingfromendifundefcollating-elementcollating-symbolifdefCHARIDS/repertoiremaps/syntax error in repertoire map definition: %sno or value givencannot save new repertoire maprepertoire map file `%s' not found-d-ccannot read character map directory `%s'.gz.bz2gzipbzip2 %ms%% alias %msfailed to read locale!failed to set locale!failed to restore %s locale![verbose] %s [warning] %s [error] %smemory exhausted;62-a\WRMHD@' $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$  @ QQQQQQQQQQ D |\=)##Vaaay1mE~%ssAAA   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~G4?hhhhhh` ppppppppppkkkkkkkkkk '-48>CV[811111111111g?sT5{\=SqqqWqqqqqqqqqqqqqqqqqqqqqqqQqqqqOqMqqqqqqKqqqqqqqqqqqqIqqqqGqU0CvbC.q\G2s^I4 wb9R3q3R%I:%M:%S %p%a %b %e %H:%M:%S %Z %Y b}9cB D/~92222222222222222222222222222222222222222222222222s2222e2Wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww wwwww wwwwwwwwwPi #w2P(- #(# wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww>A AA'A6AAAAAA&AA)AAA A AdGNU )E̍܍fiDuTc܎d0 <-D`.hvȏ ,1Đ2Ԑ3,4@p5Aؑ@@@<@d#@H@@0!HTPl$< `|T%@h@@@@p@@@@x@@@@ȵе$0<HT`lx--MX-XDDXXX-Ȫ--MX-XDDXXX-Ъ---X-XDDXXX-تXXX--XDDXXX------XDDXXX-XXXXX------X---------X-----------X--XXXXXM-----XXXXXX-XX--XXXXXXX-DD-X-X-----XDDXXX- ؞(4<HP`ص  $(,048<@DHLPTX\`dhlptx|ļȼ̼мԼؼܼ  $(,048<@DHLPTX\`dhlptx|ĽȽ̽нԽؽܽ  $(,048<@DHLPTX\`dhlptx| ؞(<HP`ص@@@<@@<N '@H<`؞?@ص\M([P@@@DS@L=L@b@@@\;@l<g.|PQ@@@@R@@@h@@Hm@@@H@&6/-wL(ت,@@ȹe@@FH@<WT@@@)@@ܹf #@k@@3@@`n@@@Ĺu"@7D{\|x@@@@@@@@@@@@@@B`@@@@0@@0l@@@@@@@y,zعvT@@@Ժ]@\h@@(p@@кr@@@H~@ț O@@̷ 94@@@88L@2@Tpa@@@@E@o@@q@@@@t}p5@@@@@Ȫ*H؛0@0d@@c@Lĸ@l@@@@,t(l@8@L@@j@@@@@`@1@@<@@@0Y@@@@@\DA@DX,Ks@@@@@@xi@T@@@@@`@@@@@pG@@@@@Ě`@@@@@@@@@ |@@@|>@@@@@@@@@p@@@@@@:I@@@@@@@H_@@@@@@@@@@@@Z@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@T@@@@@@@@@@@@@@@@@@@@@@@@@@C@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@$J@@@@@@@@@@@@@@^@@$@@@@@D@@@@@@@@@@@@@@@@@@Ъ+@@@@@@@@@@@@@@@@@@@@@@@@@@@@@4@\`@̚@@@@@@@@@@@@@@@@@@@@@@@@@U@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@|HT<r{P4hh܎ `l~B܉rD<L 08 D poh8  Ph4`h oooooO<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8<8uMKMKD'MPMNPDNONORBOMOMNPKPAKJPWPLWIPSPSEPAPANOPGPNGVPYPRYXPEPER\PHPHL`PNPCNdPLPOLhPTPRTlPRPRIvQAQATzREREU~ROROURURUSRWRWABLBLMSHSHNKNKNALCLCAMFMAFPMSPMVCVCTWSWSMrSMSMRSTSTPSASAUSNSENRSSRBSCSYCSLSLESGSGPSXSXMSKSVKSISVNSBSLBZSOSOMZAZAFGSSGSSSSSDESESPLKLKASDSDNSRSURSJSJMSESWECHCHESYSYRTWTWNTJTJKTZTZABTHTHATLTLSrTGTGOTKTKLTOTONTTTTO TNTUNTRTURTMTKMTCTCATVTUVUGUGA UAUKR$AEAREGBGBR:USUSAHUMUMIEUYURYZUZUZB\VUVUT$VEVEN^VNVNMVGVGB\VIVIRRWFWLFlEHESHYEYEMwZMZMB~ZWZWEababkabkaceaceachachadaadaadyadyaaaaraarafhafhafafrafrafaafaainainakakaakaakkakksqsqialbalealealgalgaltalttuttutamamhamhanpanpapaapaararaaraanargargarcarcarparparnarnarwarwhyhyearmruprupartartasasmasmastastathathausausmapmapavavaavaaeaveaveawaawaagragrayaycaycayaymaymazazeazeazazjazeazazbazebanbanbatbatbalbalbmbambambaibaibadbadbntbntbasbasbabakbakeueusbaqbtkbtkbejbejbebelbelbembembnbenbenberberbhbbhbbhobhobhbihbihbikbikbinbinbibisbisbynbynbrxbrxbsbosbosbrabrabrbrebrebugbugbgbulbulbuabuamymyaburcadcadcarcarcacatcatcaucaucebcebcelcelcaicainhnnhnsmlsmlchgchgcmccmcchchachacechechechrchrchychyhnechbchbnynyanyacggcggzhzhochichnchnchpchpchochocuchuchuchkchkcvchvchvnwcnwccopcopkwcorcorcocoscosmusmuscrcrecrecrpcrpcpecpecpfcpfcppcppcrhcrhhrhrvscrcuscuscscesczedakdakdadandandardardaydaydeldeldindindvdivdivdgrdgrdoidoidradraduaduadumdumnlnlddutdyudyudzdzodzoefiefiegyegyekaekaelxelxenmenmangangenengengmyvmyveoepoepoetestesteeeweeweewoewofanfanfatfatfofaofaohifhiffjfijfijfilfilfifinfinfiufiufonfonfrmfrmfrofrofrfrafrefrrfrrfrsfrsfyfryfryfurfurfffulfulgdglaglaglglgglgganganlglugluggbmgbmgaygaygaagaagbagbagezgezkakatgeogmhgmhgohgohgemgemdedeugergswgswglkglkgilgilgongongorgorgotgotgrbgrbgrcgrcelellgregngrngrngugujgujgwigwihaihaihthathathakhakhahauhauhawhawhehebhebhzherherhilhilhimhimhihinhinhohmohmohithithmnhmnczhczhhuhunhunhuphupibaibaisisliceioidoidoigiboiboijoijoiloilosmnsmnincincineineidindindinhinhiainainaieileileiuikuikuikipkipkirairamgamgasgasgagaglegleiroiroititaitajajpnjpnjvjavjavcjycjyjrbjrbjprjprkbdkbdkabkabkackacklkalkalxalxalkamkamknkankankrkaukaukaakaakrckrcmjwmjwkrlkrlkarkarkskaskascsbcsbkawkawkkkazkazkhakhakmkhmkhmkhikhikhokhokikikkikkmbkmbrwkinkinkykirkirtlhtlhkvkomkomkgkonkonkokkokkokorkorkoskoskpekpekrokrokjkuakuakumkumkukurkurkrukrukutkutladladlahlahlamlamlolaolaoltgltglalatlatlvlavlavlezlezlijlijlilimlimlnlinlinlzhlzhltlitlitjbojbondsndsdsbdsblozlozlulublublualualuiluismjsmjlunlunluoluolusluslbltzltzmkmkdmacmadmadmagmagmaimaimakmakmgmlgmlgmlmalmalmsmsamaymtmltmltmncmnccmncmnmdrmdrmanmanmnimnimnomnogvglvglvmimrimaomrmarmarchmchmmhmahmahmwrmwrmasmasmfemfemynmynmhrmhrmenmenmicmicmiqmiqminminmnpmnpcdocdonannanczoczomwlmwlmismismohmohmdfmdfmomolmolmnwmnwmkhmkhmnmonmonlollolaryarymosmosmulmulmunmunnahnahnanaunaunvnavnavndndendenrnblnblngndondonapnapnewnewnenepnepnianianicnicssassaniuniunqonqonognognonnonnainaisesmesmensonsonbnobnobnnnnonnononornornubnubnymnymnynnynnyonyonzinziocociociojojiojiororioriomormormosaosaosossossotootopalpalpaupaupipliplipampampagpagpapanpanpappappaapaapeopeofafasperphiphiphnphnponponplpolpolptporporprapraproprocpxcpxpspuspusququequequzquzrmrohrohrajrajrapraprarrarrifrifroaroaroronrumromromrnrunrunrurusrusssyssysgssgssalsalsamsamsmismismsmosmosadsadsgsagsagsasansansatsatscsrdsrdsassasscoscoselselsemsemsrsrpsccsrrsrrshnshnsnsnasnashsshsiiiiiiiiscnscnsidsidsgnsgnblablaszlszlsdsndsndsisinsinsitsitsiosiosmssmsdendenslaslaskslksloslslvslvsogsogsosomsomsonsonsnksnkckbckbwenwenstsotsotsaisaismasmaesspaspasrnsrnzghzghsuksuksuxsuxsusunsunsussusswswaswasssswsswsvsweswesycsycsyrsyrtltgltgltytahtahtaitaitgtgktgktzltzltmhtmhtatamtamtttattattetelteltertertettetththathathethebobodtibtigtigtitirtirtemtemtivtivtlitlitpitpitkltkltoktoktogtogtotontontsitsitstsotsotntsntsntcytcytumtumtuptupotaotatrturturtktuktuktvltvltyvtyvtwtwitwiudmudmugaugauguiguigukukrukrumbumbunmunmundundhsbhsbururdurduzuzbuzbvaivaivevenvenvivievievovolvolvotvotwakwakwaewaewalwalwawlnwlnwarwarwaswascycymwelwowolwolwuuwuuxhxhoxhohsnhsnsahsahyaoyaoyuwyuwyapyapyiyidyidyoyoryoryueyueypkypkzndzndzapzapzenzenzazhazhazuzulzulzunzunzzazza@$08@DLT\hp| GCC: (crosstool-NG 1.28.0) 15.2.0A2aeabi(6KZ  "D >@|4:~<'<ԅ :(g~8<A< 8P4~Q:4_:4%.?I;%.?I;%.I;c. 0/////0/1//0L/2f///////o.  /00///0////00/00/10//0L/0/2///////K. 4  .// |  |   | @4D/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/config/arm/lib1funcs.S/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/build/build-cc-gcc-core/arm-muntsos-linux-gnueabihf/libgccGNU AS 2.45__udivsi3__aeabi_uidivmod__divsi3__aeabi_idivmod__aeabi_ldiv0__aeabi_idiv0/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/build/build-cc-gcc-core/arm-muntsos-linux-gnueabihf/libgcc/export/home/pmunts/src/muntsos/toolchain/crosstool/build.d/arm-muntsos-linux-gnueabihf/src/gcc/libgcc/config/armlib1funcs.STph8`4 08 <8 p= D LX`d $OP4Ru  hE E X dd % L 4R, E 3E E 08 D @ 88 H G 4F S4F _8F F F mF G G zG8 I J J J p= D J TL P |L M (M M `L X   @ N@4 \ t Zt  eH  u   d         H   , @     " \" & & 8.  8   4 . / < E  / / 40 80 80h 2x 3 , 3 : : ; ; ; < t< < p= |= ? ? @ @ A  A dB y B B  B C C C K  XL N vvww  NN4N4 < ) H N 6N O O IO  O LP PP H_ _ ` ` w\wbw @Nn@Npy \a a a |k pl ,m 0m o @  o o `q tq dr hr `u tu v v w w* w @ w w w x x x y y y z z d{ w l{ l{ D| } } ~  4   8      4 D u      7 =  G 7 0^ P 4 ' 2 `j`x  4 Oԅ  P  <  # u <8 L8 P8 Bx  % H ; K L` ^ s   x u  H $  l   ܉l  r0& + oX 8 0L sE wW & Y wl 4# |  u <x Ht,   '\' [  l~   < 0 aH D D J 4E" X wd u  ~  4 y   <l ( 0T) :@L P< Y0 iPw s\ D 'a, 6D  >tuP N`r( @x 0m ~  -F4" Tew(X a  BH "XLl  @Rr 4R):n G_ruM $y$ \*   (M Hy  #8R0HW@0 jy{ `8 Lr ; 3 \aD 'z < HZl  u` ,   uu,|=| @Q<$ m:D wuhE x y 8 w- <? Ny [zwT\ ̀ t  uu|L p= "ARwg= A Xs( "3L J? bv"  u pAL `H wpl @ !3C w OH Zudy .$ t4 y8 w  /tq ?QaT t08 zd  `RJ   vH < !PP 1P @hT  L܎` start.os$a$dabi-note.c__abi_taginit.ccrti.ocall_weak_fncrtn.olocaledef.cerror_printprint_versionset_warningsparse_optmore_help__PRETTY_FUNCTION__.2args_docadd_to_archivereplace_archivedelete_from_archivelist_archiveforce_outputcharmap_fileinput_filelocalesargpoptionscrtstuff.call_implied_fbits__do_global_dtors_auxcompleted.0__do_global_dtors_aux_fini_array_entrycharmap.clr_errorcmlr_open.constprop.0parse_charmap.isra.0__PRETTY_FUNCTION__.0basic_charset.1asso_values.2wordlist.3linereader.caddstranslate_unicode_codepointutf8_sequence_error.isra.0utf8_decodeld-address.ciso639iso3166ld-collate.cunlink_elementcollidx_table_addoutput_weightnew_symbolnew_elementcheck_duplicateread_directionsskip_to.isra.0find_element.isra.0insert_weights__PRETTY_FUNCTION__.1insert_value__PRETTY_FUNCTION__.3handle_ellipsisoutput_weightwc__PRETTY_FUNCTION__.5__PRETTY_FUNCTION__.9__PRETTY_FUNCTION__.6__PRETTY_FUNCTION__.8__PRETTY_FUNCTION__.7__PRETTY_FUNCTION__.4nrulesatwcdefinedcollseqmbcollseqwcld-ctype.ctranslit_flattenctype_class_newctype_map_newwcwidth_table_addread_widestringget_characterctype_startup.part.0find_idx.part.0set_one_defaultallocate_arrays.isra.0digits__FUNCTION__.9negative.1negative.0no_strreplace.7longnamesuninamesvalid_table.10ld-identification.ccategory_nameld-measurement.cld-messages.cld-monetary.cmonetary_startupvalid_int_currld-name.cld-numeric.cld-paper.cld-telephone.cld-time.cempty_wstrdays_per_month.0locarchive.ccmpcategorysizedataentcmpprepare_address_spaceoldlocrecentcmpinsert_namenameentcmpenlarge_archiveadd_localeadd_aliaszeros.3nullhead.5locnameslocfile.cwordlist.9siblings_uncachedrecord_offset.part.0last_result.0last_output_path.1asso_values.8check_funcswrite_funcsrepertoire.crepertoiremap_hashrepertoire_compareknownunavailablewordlist.0md5.cfillbufcharmap-dir.cfopen_uncompressedrecord-status.csimple-hash.clookup.isra.0insert_entry_2xasprintf.cxmalloc.cfixup_null_allocxstrdup.c_udivsi3.o.udivsi3_skip_div0_testshift_divsi3.o.divsi3_skip_div0_test_dvmd_lnx.o__FRAME_END____aeabi_idivmod__aeabi_idiv0_DYNAMIC__aeabi_uidivmod_GLOBAL_OFFSET_TABLE_monetary_outputfdopen@GLIBC_2.4calloc@GLIBC_2.4strstr@GLIBC_2.4__isoc23_strtoul@GLIBC_2.38add_locale_to_archiveraise@GLIBC_2.4measurement_output__progname@GLIBC_2.4vasprintf@GLIBC_2.4__stat64_time64@GLIBC_2.34record_verbosewarn_ascii__aeabi_uidivclose_archivedelete_hash__libc_start_main@GLIBC_2.34hard_linkspaper_finishstrcmp@GLIBC_2.4__cxa_finalize@GLIBC_2.4warn_int_curr_symbollr_openposix_spawn_file_actions_adddup2@GLIBC_2.4basename@GLIBC_2.4__environ@GLIBC_2.4pop_localerepertoire_complain__bss_start____isoc23_fscanf@GLIBC_2.38regerror@GLIBC_2.4read@GLIBC_2.4repertoire_globalalias_filecompute_hashvalwrite_locale_dataaddress_finishmemmove@GLIBC_2.4lockf64@GLIBC_2.4__dcgettext@GLIBC_2.4charmap_readdiridentification_readend_locale_preludecharmap_find_symboladd_locale_stringfgets@GLIBC_2.4paper_outputctype_finishcharmap_readnumeric_readswap_endianness_pshow_archive_contentmonetary_finishmmap64@GLIBC_2.4_edataalign_locale_datacharmap_openctype_outputftruncate64@GLIBC_2.4collate_read_obstack_newchunk@GLIBC_2.4numeric_outputstpcpy@GLIBC_2.4add_locale_emptyrepertoire_find_seq_finimonetary_read__bss_end__strdup@GLIBC_2.4obstack_free@GLIBC_2.4init_hash_nl_explode_nameidentification_outputlr_eof_obstack_begin@GLIBC_2.4sysconf@GLIBC_2.4init_locale_dataunlink@GLIBC_2.4insert_entryrealloc@GLIBC_2.4time_read_nl_normalize_codesetxreallocmessages_finishlr_createtextdomain@GLIBC_2.4__getpagesize@GLIBC_2.4posix_spawn_file_actions_init@GLIBC_2.4strcasecmp@GLIBC_2.4messages_read__fstat64_time64@GLIBC_2.34address_outputstderr@GLIBC_2.4__md5_read_ctxxmalloccharmap_aliaseslseek64@GLIBC_2.4regfree@GLIBC_2.4wmemcpy@GLIBC_2.4xstrdupadd_locale_charposix_spawn_file_actions_addclose@GLIBC_2.4strcpy@GLIBC_2.4__md5_process_byteslr_tokenpread64@GLIBC_2.4creat64@GLIBC_2.4strtok_r@GLIBC_2.4__nanosleep64@GLIBC_2.34__aeabi_ldiv0wcscmp@GLIBC_2.4opendir@GLIBC_2.4address_read__md5_process_blockstart_locale_preludehandle_copygetenv@GLIBC_2.4mkstemp64@GLIBC_2.4next_primemax_locarchive_open_retryname_read__data_startputs@GLIBC_2.4malloc@GLIBC_2.4__md5_buffererror_at_line@GLIBC_2.4strerror@GLIBC_2.4xmalloc_exit_failurecharmap_hashlr_closestrsep@GLIBC_2.4ctype_read__ctype_tolower_loc@GLIBC_2.4__gmon_start__find_translitload_localelr_nextrename@GLIBC_2.4__udivsi3__dso_handle__ctype_b_loc@GLIBC_2.4exit@GLIBC_2.4add_locale_wstringfeof@GLIBC_2.4numeric_finishrepertoire_find_value_IO_stdin_usedname_outputstrlen@GLIBC_2.4write_all_categorieslocfile_read__isoc23_strtol@GLIBC_2.38strchr@GLIBC_2.4__md5_init_ctxrecord_error_at_linetime_finishfprintf@GLIBC_2.4wmemcmp@GLIBC_2.4__divsi3stdin@GLIBC_2.4identification_finishopen_archive__errno_location@GLIBC_2.4argp_help@GLIBC_2.4snprintf@GLIBC_2.4mkdir@GLIBC_2.4tsearch@GLIBC_2.4posix_conformanceoutput_prefixadd_locale_raw_datamemset@GLIBC_2.4delete_locales_from_archivecheck_all_categories_endstrncpy@GLIBC_2.4argp_parse@GLIBC_2.4obstack_printf@GLIBC_2.4no_archivemeasurement_readrecord_warningxasprintfbe_quietposix_spawnp@GLIBC_2.15write@GLIBC_2.4telephone_readadd_locale_uint32record_errorargp_err_exit_status@GLIBC_2.4__end__iterate_tableset_entrymessages_outputstdout@GLIBC_2.4writev@GLIBC_2.4enc_not_ascii_compatible__bss_startfclose@GLIBC_2.4find_localemainpipe@GLIBC_2.4error_print_progname@GLIBC_2.4munmap@GLIBC_2.4recorded_error_count__lstat64_time64@GLIBC_2.34tfind@GLIBC_2.4add_locale_raw_obstacksetlocale@GLIBC_2.4wcschr@GLIBC_2.4posix_spawn_file_actions_destroy@GLIBC_2.4end_locale_structurecharmap_find_valuewcslen@GLIBC_2.4add_locales_to_archiveadd_locale_uint32_arraynewlocale@GLIBC_2.4collate_outputtime_outputreaddir64@GLIBC_2.4start_locale_structureregcomp@GLIBC_2.4_libc_intl_domainname@GLIBC_2.4repertoire_find_symbol__md5_finish_ctxfind_entryfopen64@GLIBC_2.4qsort@GLIBC_2.4push_localepaper_readcopy_listeuidaccess@GLIBC_2.4fgets_unlocked@GLIBC_2.4program_invocation_short_name@GLIBC_2.4__aeabi_idivlocfile_hashcharmap_closedirlr_ignore_restrecorded_warning_countrandom@GLIBC_2.4getdelim@GLIBC_2.4charmap_opendirstrncmp@GLIBC_2.4abort@GLIBC_2.4_nl_make_l10nflist_initxcallocclosedir@GLIBC_2.4argp_program_version_hookadd_to_readlistmeasurement_finishcharmap_free_aliasestelephone_output__assert_fail@GLIBC_2.4fchmod@GLIBC_2.4repertoire_readcollate_finishname_finishtelephone_finish.symtab.strtab.shstrtab.interp.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.note.ABI-tag.fini_array.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributes.debug_aranges.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_line_strTT'pp#ohh - 588=oJoPY ``h b B44hk0808 f<8<80qp=p=JwDD}LL YpXX ``dd   $$OO?P@44R4Bp#ue(0e"pe3f``fgvg)(hh50 im@0jkP8"t ]MP